IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bleeding due to disruption of a cargo-specific ER-to-Golgi transport complex. Bleeding due to disruption of a cargo-specific ER-to-Golgi transport complex. Nature genetics 2003 imex curation Zhang B., Cunningham MA., Nichols WC., Bernat JA., Seligsohn U., Pipe SW., McVey JH., Schulte-Overberg U., de Bosch NB., Ruiz-Saez A., White GC., Tuddenham EG., Kaufman RJ., Ginsburg D. Rare diseases - Interactions investigated in the context of Rare genetic disease ginsburg@umich.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang B., Cunningham MA., Nichols WC., Bernat JA., Seligsohn U., Pipe SW., McVey JH., Schulte-Overberg U., de Bosch NB., Ruiz-Saez A., White GC., Tuddenham EG., Kaufman RJ., Ginsburg D. Rare diseases - Interactions investigated in the context of Rare genetic disease Interaction with LAMN1-construct was not captured as the origin of species was not known ginsburg@umich.edu Accepted 2020-AUG-12 AT 07:25 BST AT 07:25 BST by LIVIAP Nature genetics 2003 Only protein-protein interactions imex curation imex curation Bleeding due to disruption of a cargo-specific ER-to-Golgi transport complex. Bleeding due to disruption of a cargo-specific ER-to-Golgi transport complex. Nature genetics 2003 imex curation Zhang B., Cunningham MA., Nichols WC., Bernat JA., Seligsohn U., Pipe SW., McVey JH., Schulte-Overberg U., de Bosch NB., Ruiz-Saez A., White GC., Tuddenham EG., Kaufman RJ., Ginsburg D. Rare diseases - Interactions investigated in the context of Rare genetic disease ginsburg@umich.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhang B., Cunningham MA., Nichols WC., Bernat JA., Seligsohn U., Pipe SW., McVey JH., Schulte-Overberg U., de Bosch NB., Ruiz-Saez A., White GC., Tuddenham EG., Kaufman RJ., Ginsburg D. Rare diseases - Interactions investigated in the context of Rare genetic disease ginsburg@umich.edu Accepted 2020-AUG-12 AT 07:25 BST AT 07:25 BST by LIVIAP Nature genetics 2003 Only protein-protein interactions imex curation imex curation Bleeding due to disruption of a cargo-specific ER-to-Golgi transport complex. Bleeding due to disruption of a cargo-specific ER-to-Golgi transport complex. Nature genetics 2003 imex curation Zhang B., Cunningham MA., Nichols WC., Bernat JA., Seligsohn U., Pipe SW., McVey JH., Schulte-Overberg U., de Bosch NB., Ruiz-Saez A., White GC., Tuddenham EG., Kaufman RJ., Ginsburg D. Rare diseases - Interactions investigated in the context of Rare genetic disease ginsburg@umich.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Cunningham MA., Nichols WC., Bernat JA., Seligsohn U., Pipe SW., McVey JH., Schulte-Overberg U., de Bosch NB., Ruiz-Saez A., White GC., Tuddenham EG., Kaufman RJ., Ginsburg D. Rare diseases - Interactions investigated in the context of Rare genetic disease ginsburg@umich.edu Accepted 2020-AUG-12 AT 07:25 BST AT 07:25 BST by LIVIAP Nature genetics 2003 Only protein-protein interactions imex curation imex curation mcfd2_human Multiple coagulation factor deficiency protein 2 SDNSF Neural stem cell-derived neuronal survival protein MCFD2 protein protein human Homo sapiens Human MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ DIP protein Q8NI22 original sequence version: 77 EF3F3B28E5C7A8A8 mcfd2 mcfd2 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey lman1_chlae Protein ERGIC-53 ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 LMAN1 ERGIC53 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MAGSRRRGLQARVRPLFCALLLSLSRFVGGDGVGGDPAAGLPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKAKAAFENWEVEVTFRVTGRGRIGADGLAIWYTENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKIIYYQKTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGVSAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQISQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETAQHFADIKEHLHTVKRDIDNLVQRHMLSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF 02D82CD3C89E4F5F mcfd2-lman1-1 1 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q8NI22:p.Ile136Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I T Tue Jun 30 19:30:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile136Thr' Q8NI22:p.Ile136Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 19:46:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile136Val' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8NI22:p.Asp129Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D E Tue Jun 30 18:08:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp129Glu' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5 lman1-mcfd2-12 3 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5 lman1-mcfd2-13 2 6 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q8NI22:p.Ile136Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I T Tue Jun 30 19:55:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile136Thr' Q8NI22:p.Ile136Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 18:42:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile136Val' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8NI22:p.Asp129Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D E Tue Jun 30 18:52:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp129Glu' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5