IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. The Journal of cell biology 2001 imex curation Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu 03-Oct-2019: Contacted by IntAct-Help. Human heart LexA cDNA library Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu Accepted 2019-SEP-18 AT 08:37 BST AT 08:37 BST by PPORRAS Human heart LexA cDNA library The Journal of cell biology 2001 Only protein-protein interactions imex curation imex curation A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. The Journal of cell biology 2001 imex curation Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu 03-Oct-2019: Contacted by IntAct-Help. Human heart LexA cDNA library Only protein-protein interactions imex curation mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. Figure 3e, 4d, 5c & 9c were not captured as there were no interaction detected with paxillin carywu@imap.pitt.edu Accepted 2019-SEP-18 AT 08:37 BST AT 08:37 BST by PPORRAS Human heart LexA cDNA library The Journal of cell biology 2001 Only protein-protein interactions imex curation imex curation A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. The Journal of cell biology 2001 imex curation Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu 03-Oct-2019: Contacted by IntAct-Help. Human heart LexA cDNA library Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu Accepted 2019-SEP-18 AT 08:37 BST AT 08:37 BST by PPORRAS Human heart LexA cDNA library The Journal of cell biology 2001 Only protein-protein interactions imex curation imex curation A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. The Journal of cell biology 2001 imex curation Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu 03-Oct-2019: Contacted by IntAct-Help. Human heart LexA cDNA library Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. Figure 3e, 4d, 5c & 9c were not captured as there were no interaction detected with paxillin carywu@imap.pitt.edu Accepted 2019-SEP-18 AT 08:37 BST AT 08:37 BST by PPORRAS Human heart LexA cDNA library The Journal of cell biology 2001 Only protein-protein interactions imex curation imex curation A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. The Journal of cell biology 2001 imex curation Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu 03-Oct-2019: Contacted by IntAct-Help. Human heart LexA cDNA library Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu Accepted 2019-SEP-18 AT 08:37 BST AT 08:37 BST by PPORRAS Human heart LexA cDNA library The Journal of cell biology 2001 Only protein-protein interactions imex curation imex curation A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading. The Journal of cell biology 2001 imex curation Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. carywu@imap.pitt.edu 03-Oct-2019: Contacted by IntAct-Help. Human heart LexA cDNA library Only protein-protein interactions imex curation mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tu Y., Huang Y., Zhang Y., Hua Y., Wu C. Figure 3e, 4d, 5c & 9c were not captured as there were no interaction detected with paxillin carywu@imap.pitt.edu Accepted 2019-SEP-18 AT 08:37 BST AT 08:37 BST by PPORRAS Human heart LexA cDNA library The Journal of cell biology 2001 Only protein-protein interactions imex curation imex curation lims1_mouse LIM and senescent cell antigen-like-containing domain protein 1 Lims1 Pinch1 Particularly interesting new Cys-His protein 1 protein protein mouse Mus musculus Mouse MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVSCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLSETLGRK DIP protein Q99JW4 original sequence version: 82 E665FEA59B5FFDFE parva_mouse Alpha-parvin Parva Actp Actopaxin MNCb-0301 protein protein mouse Mus musculus Mouse MATSPQKSPLVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSEFQEEGMNAINLPLSPISFELDPEDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE DIP protein Q9EPC1 original sequence version: 87 1251F2586A1ACBC6 ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein Q13418 original sequence version: 114 DIP protein Q13418 original sequence version: 163 E37DC2AD5311A1C2 ilk_mouse Integrin-linked protein kinase 59 kDa serine/threonine-protein kinase Beta-integrin-linked kinase ILK-1 ILK-2 ILK1 ILK2 p59ILK Ilk protein protein mouse Mus musculus Mouse MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein O55222 original sequence version: 112 F41960CF8EC503A7 c0ssx9_crigr 59 kDa serine/threonine-protein kinase ilk Beta-integrin-linked kinase ILK-1 ILK-2 Integrin-linked protein kinase p59ILK CgPICR_020308 H671_3g9025 I79_021724 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQSNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK 02C20214E373DC8B lims1_human LIM and senescent cell antigen-like-containing domain protein 1 LIMS1 Particularly interesting new Cys-His protein 1 Renal carcinoma antigen NY-REN-48 PINCH PINCH1 protein protein human Homo sapiens Human MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK DIP protein P48059 original sequence version: 110 E665FEB11D849CAE parva_human Alpha-parvin Calponin-like integrin-linked kinase-binding protein CH-ILKBP Matrix-remodeling-associated protein 2 Actopaxin PARVA MXRA2 protein protein human Homo sapiens Human MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE DIP protein Q9NVD7 original sequence version: null F48BB5B1E83F8CEF g3hj13_crigr LIM and senescent cell antigen-like-containing domain protein I79_010647 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVSCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK E665FEA59B5FE59E ilk-parva-11 5 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association NA ilk-lims1-9 1 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table1, Figure 1c ilk-parva-12 3 10 unspecified role unspecified role prey prey cell lysate cell lysate mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast 13 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9NVD7:p.Phe271Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F D Tue Jun 30 18:17:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe271Asp' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain range range ecoli Escherichia coli (strain K12) physical association physical association Figure 2a, 2b, 8b ilk-parva-14 6 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4b, 4c ilk-lims1-10 2 8 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 3c, 3f ilk-parva-15 1 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table1, Figure 1c ilk-lims1-12 6 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 5b, 5d parva-g3hj13_crigr-1 4 14 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NVD7:p.Phe271Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F D Tue Jun 30 18:49:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe271Asp' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain range range 11 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 9b, 9d