DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The N-terminal region of cystatin A (stefin A) binds to papain subsequent to the two hairpin loops of the inhibitor. Demonstration of two-step binding by rapid-kinetic studies of cystatin A labeled at the N-terminus with a fluorescent reporter group. The N-terminal region of cystatin A (stefin A) binds to papain subsequent to the two hairpin loops of the inhibitor. Demonstration of two-step binding by rapid-kinetic studies of cystatin A labeled at the N-terminus with a fluorescent reporter group. Protein science : a publication of the Protein Society 2000 imex curation Estrada S., Olson ST., Raub-Segall E., Björk I. Ingemar.Bjork@vmk.slu.se. 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Estrada S., Olson ST., Raub-Segall E., Björk I. Ingemar.Bjork@vmk.slu.se. Accepted 2019-JUN-21 AT 07:28 BST AT 07:28 BST by ORCHARD Protein science : a publication of the Protein Society 2000 imex curation Hi Sandra! -As for the his tag, they mention that they cleaved the his tag a few sentences after mentioning it : "As the formation of dimers, like those seen with cystatin B(Turk et al., 1992), might have interfered with the cleavage of the His-tag by enterokinase, the protein was treated with DTT before incubation with the enzyme." -About the Kds, I believe it was agreed on not entering Kds as the information might not be usable for conditions other than the original experiment. -As for the stoichiometry, although they do mention it in the paper, it can not be determined based on the graphs they have provided. Thank you! cyta_human Cystatin-A Cystatin-AS Stefin-A CSTA STF1 STFA protein protein human Homo sapiens Human MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF 2F5F0D61C91305EE papa1_carpa Papain Papaya proteinase I protein protein papaya Carica papaya MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN mint 82D9FB35EDCA12EF csta-papa1_carpa-1 1 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified papaya Carica papaya 2 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified AANS-Cystatin A AANS-Cystatin A fluorescent dye fluorescent dye label fluorescent dye n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1, Table 1 csta-papa1_carpa-2 1 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified papaya Carica papaya 2 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified AEDANS-Cystatin A AEDANS-Cystatin A fluorescent dye fluorescent dye label fluorescent dye n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1, Table 1