IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SMN tudor domain structure and its interaction with the Sm proteins. SMN tudor domain structure and its interaction with the Sm proteins. Nature structural biology 2001 imex curation Selenko P., Sprangers R., Stier G., Bühler D., Fischer U., Sattler M. Rare diseases - Interactions investigated in the context of Rare genetic disease sattler@EMBL-Heidelberg.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Selenko P., Sprangers R., Stier G., Bühler D., Fischer U., Sattler M. Rare diseases - Interactions investigated in the context of Rare genetic disease sattler@EMBL-Heidelberg.de Accepted 2020-FEB-10 AT 10:44 GMT AT 10:44 GMT by MGT Nature structural biology 2001 Only protein-protein interactions imex curation imex curation SMN tudor domain structure and its interaction with the Sm proteins. SMN tudor domain structure and its interaction with the Sm proteins. Nature structural biology 2001 imex curation Selenko P., Sprangers R., Stier G., Bühler D., Fischer U., Sattler M. Rare diseases - Interactions investigated in the context of Rare genetic disease sattler@EMBL-Heidelberg.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down autoradiography autoradiography Selenko P., Sprangers R., Stier G., Bühler D., Fischer U., Sattler M. Rare diseases - Interactions investigated in the context of Rare genetic disease sattler@EMBL-Heidelberg.de Accepted 2020-FEB-10 AT 10:44 GMT AT 10:44 GMT by MGT Nature structural biology 2001 Only protein-protein interactions imex curation imex curation smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR DIP protein P62314 original sequence version: 77 DIP protein P62314 original sequence version: 100 DIP protein P62314 original sequence version: 86 DIP protein P62314 original sequence version: 135 0C81C94BF98E0810 smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B smd3_human Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein human Homo sapiens Human MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR DIP protein P62318 original sequence version: 72 DIP protein P62318 original sequence version: 95 DIP protein P62318 original sequence version: 81 DIP protein P62318 original sequence version: 102 DIP protein P62318 original sequence version: 131 59A6E78E860AA3E0 smn1-snrpd1-3 2 4 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated Q16637:p.Glu134Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 17:36:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu134Lys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2a snrpd3-smn1-1 2 4 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated Q16637:p.Glu134Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 16:44:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu134Lys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 2a smn1-snrpd1-4 2 3 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2b smn1-snrpd1-5 1 4 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region_including_tudor_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q16637:p.Glu134Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 18:45:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu134Lys' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 3a, 3d