IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Dopamine D1 and adenosine A1 receptors form functionally interacting heteromeric complexes. Dopamine D1 and adenosine A1 receptors form functionally interacting heteromeric complexes. Proceedings of the National Academy of Sciences of the United States of America 2000 imex curation Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R., Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R. The dopamine D1 receptor identified as Uniprot P21728 from PMID:2168520 r.franco@sun.bq.ub.es 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R., Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R. LTK(-) fibroblasts:- mouse L cells deficient in thymidine kinase (tk) The dopamine D1 receptor identified as Uniprot P21728 from PMID:2168520 r.franco@sun.bq.ub.es Accepted 2019-SEP-10 AT 13:20 BST AT 13:20 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2000 Only protein-protein interactions imex curation imex curation Dopamine D1 and adenosine A1 receptors form functionally interacting heteromeric complexes. Dopamine D1 and adenosine A1 receptors form functionally interacting heteromeric complexes. Proceedings of the National Academy of Sciences of the United States of America 2000 imex curation Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R., Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R. The dopamine D1 receptor identified as Uniprot P21728 from PMID:2168520 r.franco@sun.bq.ub.es 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R., Ginés S., Hillion J., Torvinen M., Le Crom S., Casadó V., Canela EI., Rondin S., Lew JY., Watson S., Zoli M., Agnati LF., Verniera P., Lluis C., Ferré S., Fuxe K., Franco R. LTK(-) fibroblasts:- mouse L cells deficient in thymidine kinase (tk) The dopamine D1 receptor identified as Uniprot P21728 from PMID:2168520 r.franco@sun.bq.ub.es Accepted 2019-SEP-10 AT 13:20 BST AT 13:20 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2000 Only protein-protein interactions imex curation imex curation aa1r_human Adenosine receptor A1 ADORA1 protein protein human Homo sapiens Human MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD 1B555893BCDEC9A6 drd1_human D(1A) dopamine receptor DRD1 Dopamine D1 receptor protein protein human Homo sapiens Human MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT 64E062D765D0DBA7 adora1-drd1-1 1 4 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 1 SKF-38393, a D1R agonist. A1R agonist R-PIA (CHEMBL139000) reversed this effect. adora1-drd1-2 2 4 unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep 3 unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep colocalization colocalization Figure 2 SKF-38393, a D1R agonist separately or combined with A1R agonist R-PIA (CHEMBL139000). R-PIA induced the aggregation of both proteins in clusters seen as punctate fluorescence, where colocalizations between adenosine and dopamine receptors approach 100%