IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Context-dependent transcriptional cooperation mediated by cardiac transcription factors Csx/Nkx-2.5 and GATA-4. Context-dependent transcriptional cooperation mediated by cardiac transcription factors Csx/Nkx-2.5 and GATA-4. The Journal of biological chemistry 1999 imex curation Shiojima I., Komuro I., Oka T., Hiroi Y., Mizuno T., Takimoto E., Monzen K., Aikawa R., Akazawa H., Yamazaki T., Kudoh S., Yazaki Y. From PMID: 8888684 ha-csx/nkx2-5 is human. komuro-tky@umin.ac.jp 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shiojima I., Komuro I., Oka T., Hiroi Y., Mizuno T., Takimoto E., Monzen K., Aikawa R., Akazawa H., Yamazaki T., Kudoh S., Yazaki Y. From PMID: 8888684 ha-csx/nkx2-5 is human. komuro-tky@umin.ac.jp Accepted 2019-JUN-24 AT 17:16 BST AT 17:16 BST by MGT The Journal of biological chemistry 1999 Only protein-protein interactions imex curation imex curation Context-dependent transcriptional cooperation mediated by cardiac transcription factors Csx/Nkx-2.5 and GATA-4. Context-dependent transcriptional cooperation mediated by cardiac transcription factors Csx/Nkx-2.5 and GATA-4. The Journal of biological chemistry 1999 imex curation Shiojima I., Komuro I., Oka T., Hiroi Y., Mizuno T., Takimoto E., Monzen K., Aikawa R., Akazawa H., Yamazaki T., Kudoh S., Yazaki Y. From PMID: 8888684 ha-csx/nkx2-5 is human. komuro-tky@umin.ac.jp 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down autoradiography autoradiography Shiojima I., Komuro I., Oka T., Hiroi Y., Mizuno T., Takimoto E., Monzen K., Aikawa R., Akazawa H., Yamazaki T., Kudoh S., Yazaki Y. From PMID: 8888684 ha-csx/nkx2-5 is human. komuro-tky@umin.ac.jp Accepted 2019-JUN-24 AT 17:16 BST AT 17:16 BST by MGT The Journal of biological chemistry 1999 Only protein-protein interactions imex curation imex curation nkx25_human Homeobox protein Nkx-2.5 NKX2-5 CSX NKX2.5 NKX2E Homeobox protein NK-2 homolog E Cardiac-specific homeobox Homeobox protein CSX protein protein human Homo sapiens Human MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW ACCC9C2F9C292586 gata4_human Transcription factor GATA-4 GATA4 GATA-binding factor 4 protein protein human Homo sapiens Human MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA Defects in GATA4 are the cause of atrial septal defect type 2 (ASD2) [MIM:607941]. ASD2 is a congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria. ASD2 patients show other heart abnormalities including ventricular and atrioventricular septal defects, pulmonary valve thickening or insufficiency of the cardiac valves. ASD2 is not associated with defects in the cardiac conduction system or non-cardiac abnormalities mint Transcriptional activator. Binds to the consensus sequence 5'-AGATAG-3'. Acts as a transcriptional activator of ANF in cooperation with NKX2-5 141B8CD841E12C7B nkx2_5-gata4-1 2 4 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range sufficient to bind sufficient binding region sufficient to bind range range range range rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 3 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig. 6B,C csx-gata4-1 1 4 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6A