MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url&gt;http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it TROY interacts with RKIP to promote glioma development. TROY interacts with RKIP to promote glioma development. Oncogene 2018 imex curation Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u87 Human U-87 MG glioblastoma cell line u87 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Accepted 2018-NOV-23 AT 15:03 GMT AT 15:03 GMT by LUANA Oncogene 2018 Only protein-protein interactions imex curation imex curation TROY interacts with RKIP to promote glioma development. TROY interacts with RKIP to promote glioma development. Oncogene 2018 imex curation Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Accepted 2018-NOV-23 AT 15:03 GMT AT 15:03 GMT by LUANA Oncogene 2018 Only protein-protein interactions imex curation imex curation TROY interacts with RKIP to promote glioma development. TROY interacts with RKIP to promote glioma development. Oncogene 2018 imex curation Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u87 Human U-87 MG glioblastoma cell line u87 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Accepted 2018-NOV-23 AT 15:03 GMT AT 15:03 GMT by LUANA Oncogene 2018 Only protein-protein interactions imex curation imex curation TROY interacts with RKIP to promote glioma development. TROY interacts with RKIP to promote glioma development. Oncogene 2018 imex curation Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Accepted 2018-NOV-23 AT 15:03 GMT AT 15:03 GMT by LUANA Oncogene 2018 Only protein-protein interactions imex curation imex curation TROY interacts with RKIP to promote glioma development. TROY interacts with RKIP to promote glioma development. Oncogene 2018 imex curation Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Accepted 2018-NOV-23 AT 15:03 GMT AT 15:03 GMT by LUANA Oncogene 2018 Only protein-protein interactions imex curation imex curation pebp1_human Phosphatidylethanolamine-binding protein 1 Prostatic-binding protein HCNPpp Neuropolypeptide h3 Raf kinase inhibitor protein PEBP1 PEBP PBP protein protein human Homo sapiens Human MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK DIP protein P30086 original sequence version: 136 F1E9F17E2CD11C36 gdir1_human Rho GDP-dissociation inhibitor 1 Rho-GDI alpha ARHGDIA GDIA1 protein protein human Homo sapiens Human MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD 59CB6F42E3B3BCCA tnr19_human Tumor necrosis factor receptor superfamily member 19 Toxicity and JNK inducer TRADE UNQ1888/PRO4333 TNFRSF19 TAJ TROY protein protein human Homo sapiens Human MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSICGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSNSSQDLVGGAVPVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRLGSL B5891CEA9ED45361 tnr19_mouse Tumor necrosis factor receptor superfamily member 19 Tnfrsf19 Taj Troy TRADE Toxicity and JNK inducer protein protein mouse Mus musculus Mouse MALKVLPLHRTVLFAAILFLLHLACKVSCETGDCRQQEFKDRSGNCVLCKQCGPGMELSKECGFGYGEDAQCVPCRPHRFKEDWGFQKCKPCADCALVNRFQRANCSHTSDAVCGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCTSKVNLVKISSTVSSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDQPRLRHCAHRACCQYHRDSAPMYGPVHLIPSLCCEEARSSARAVLGCGLRSPTTLQERNPASVGDTMPAFFGSVSRSICAEFSDAWPLMQNPLGGDSSLCDSYPELTGEDTNSLNPENESAASLDSSGGQDLAGTAALESSGNVSESTDSPRHGDTGTVWEQTLAQDAQRTPSQGGWEDRENLNLAMPTAFQDA 9BDC7C7A2D6A9C47 phb_human Prohibitin PHB PHB1 protein protein human Homo sapiens Human MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ 915494273E342C76 1-128 1 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3a Moreover, in the lysates of the cultured U87 cells, the endogenous interactions of TROY with RKIP, prohibitin, or RhoGDIα were detected. The data suggest that TROY interacts with RKIP, prohibitin and RhoGDIα in glioma cells (Fig. 3a–f) pebp1-tnfrsf19-1 1 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3b Moreover, in the lysates of the cultured U87 cells, the endogenous interactions of TROY with RKIP, prohibitin, or RhoGDIα were detected. The data suggest that TROY interacts with RKIP, prohibitin and RhoGDIα in glioma cells (Fig. 3a–f). tnfrsf19-pebp1-1 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3c Moreover, in the lysates of the cultured U87 cells, the endogenous interactions of TROY with RKIP, prohibitin, or RhoGDIα were detected. The data suggest that TROY interacts with RKIP, prohibitin and RhoGDIα in glioma cells (Fig. 3a–f). phb-tnfrsf19-1 1 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3d F4a Moreover, in the lysates of the cultured U87 cells, the endogenous interactions of TROY with RKIP, prohibitin, or RhoGDIα were detected. The data suggest that TROY interacts with RKIP, prohibitin and RhoGDIα in glioma cells (Fig. 3a–f). the FBS treatment did not affect the association of TROY with prohibitin or RhoGDIα. phb-tnfrsf19-2 1 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3e Moreover, in the lysates of the cultured U87 cells, the endogenous interactions of TROY with RKIP, prohibitin, or RhoGDIα were detected. The data suggest that TROY interacts with RKIP, prohibitin and RhoGDIα in glioma cells (Fig. 3a–f). tnfrsf19-phb-1 1 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3f f4a Moreover, in the lysates of the cultured U87 cells, the endogenous interactions of TROY with RKIP, prohibitin, or RhoGDIα were detected. The data suggest that TROY interacts with RKIP, prohibitin and RhoGDIα in glioma cells (Fig. 3a–f). the FBS treatment did not affect the association of TROY with prohibitin or RhoGDIα. phb-tnfrsf19-3 3 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3g We also examined if TROY and its binding-partners were co-localized in the glioma cells. TROY and the binding partners were observed to be co-expressed in the glioma cells through immunocytochemical staining (Fig. 3g). pebp1-tnfrsf19-2 3 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3g We also examined if TROY and its binding-partners were co-localized in the glioma cells. TROY and the binding partners were observed to be co-expressed in the glioma cells through immunocytochemical staining (Fig. 3g). arhgdia-tnfrsf19-1 3 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3g We also examined if TROY and its binding-partners were co-localized in the glioma cells. TROY and the binding partners were observed to be co-expressed in the glioma cells through immunocytochemical staining (Fig. 3g). tnfrsf19-pebp1-2 1 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4a we examined the interaction of TROY with RKIP, prohibitin, and RhoGDIα in glioma cells after FBS exposure. As shown in Fig. 4a–d, the interaction of TROY with RKIP was significantly enhanced after FBS exposure in the glioma cells. FBS tnfrsf19-pebp1-3 2 6 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 competitor competitor competitor unspecified role unspecified role purified purified tat tag tat tag transactivating tag Tat tag tat tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f5a f5c We then performed a GST pull-down assay to evaluate if TROY binds RKIP directly. Consistent with the above findings, GST-TROY-ICD interacts with His-RKIP (Fig. 5a).This indicates that TROY binds RKIP directly We further examined whether TROY (234–371 aa) could disrupt the interaction between TROY and RKIP. We prepared TROY (234–371 aa) protein tagged with TAT peptide. The GST-TROY-ICD and His-RKIP fusion proteins were incubated with the TAT protein (10 μM). Then, the GST pull-down assay was performed. RKIP bound to TROY was remarkably decreased when the TAT protein was applied (Fig. 5c, d), suggesting that the TAT-TROY (234–371 aa) protein can disrupt the interaction of TROY/RKIP in vitro. pebp1-tnfrsf19-4 4 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf4a pebp1-tnfrsf19-3 4 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf4b tnfrsf19-pebp1-4 4 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf4d tnfrsf19-phb-2 4 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf4c tnfrsf19-pebp1-5 5 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association sf4e tnfrsf19-pebp1-6 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association sf4f