DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Nature 2018 imex curation Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Accepted 2018-SEP-24 AT 15:22 BST AT 15:22 BST by ORCHARD Nature 2018 imex curation Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Nature 2018 imex curation Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient Human 293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient ATCC® CRL-3022 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Accepted 2018-SEP-24 AT 15:22 BST AT 15:22 BST by ORCHARD Nature 2018 imex curation Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Nature 2018 imex curation Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient Human 293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient ATCC® CRL-3022 crosslink cross-linking study crosslink predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Accepted 2018-SEP-24 AT 15:22 BST AT 15:22 BST by ORCHARD Nature 2018 imex curation Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Nature 2018 imex curation Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Accepted 2018-SEP-24 AT 15:22 BST AT 15:22 BST by ORCHARD Nature 2018 imex curation Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Cryo-EM structures of fungal and metazoan mitochondrial calcium uniporters. Nature 2018 imex curation Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation picpa Pichia pastoris (Yeast) Yeast Pichia pastoris crosslink cross-linking study crosslink predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Accepted 2018-SEP-24 AT 15:22 BST AT 15:22 BST by ORCHARD Nature 2018 imex curation q8ne86-1 Calcium uniporter protein, mitochondrial MCU C10orf42 CCDC109A Coiled-coil domain-containing protein 109A protein protein human Homo sapiens Human MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD DIP protein Q8NE86-1 original sequence version: 60 DIP protein Q8NE86 original sequence version: 103 w2sde2_9euro Calcium uniporter protein HMPREF1541_00236 protein protein Cyphellophora europaea CBS 101466 Cyphellophora europaea CBS 101466 MTKGKLLTTPSRLLKLVLPLSTVDHNTDRKDVAPLALLVHPQQPLSYLERLIQAELPPPDPQDSKSTTRSVTFRAMEAKDDEIKPRKKADTEGGGGSDGSVQSYSGAGREGEGKDEGEFVRWSPSTEIGDFIRDAARAKEFEVEIEGSPGVIKVAVPSFNDRTYYLRQRLRRTSRKISKLAAIKEECDKAAHRGAQRIALAGCGGLIGYWYIVYRLTFETDLGWDVMEPVTYLVGLSTLIGGYMWFLWHNREVSYRSALNITVSARQNKLYQAKGFSLQDWEGYLEEANAMRREIKAVASEYDVDWNETQDEGGDEKVTKALRDERKNNNGTKNKSKEGEEDDEDD 1127B246873E8A3B mcu_danre Calcium uniporter protein, mitochondrial mcu zgc:153607 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAAKVCRSVLLLSRSSGAVASSAYPAFGVSSQRHQGTKTEALSMSLGGHQTVRRAHGLRTGGRCALFCHPSATLTAQGWKGSPSWQVQRLLCSPAAEDVSVVYQNGLPVISVRLPSRRERCQFTLKPLSDTVGVFLQQLQAEDRGIDRVTIYSADGARIASSTGIDILLMDNFKLVINDTSYLVQPPRRDLLPHEDGERLNDVKILVQQLYTTLRIEEHQLNKERELIGRLEDLNSQLQPLEKVKEELSKKAERRTTWVLWGGMAYMATQFGILARLTWWEYSWDIMEPVTYFITYGTAMAMYAYFVLTRQEYLYPDARDRQYLLFFHRGAKRTRFDIEKYNKLKDAIAEAELDLKRLRDPLQLNLPIQQIDTSKD EB9696F06AE12AC8 w2sde2_9euro-1 1 7 unspecified role unspecified role neutral component neutral component purified purified GEGEEF tag GEGEEF tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range New protein affinity tag required see PMID - 6811596 direct interaction direct interaction Fig 1, Extended Data Table 1 w2sde2_9euro-2 5 7 unspecified role unspecified role neutral component neutral component purified purified GEGEEF tag GEGEEF tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range New protein affinity tag required see PMID - 6811596 direct interaction direct interaction Extended Data Fig 2h mcu-1 2 8 unspecified role unspecified role neutral component neutral component purified purified TETSQVAPA tag 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range New protein affinity tag required. See PMID - 25299155 direct interaction direct interaction Fig 2 mcu-6 3 8 unspecified role unspecified role neutral component neutral component purified purified TETSQVAPA tag 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range New protein affinity tag required. See PMID - 25299155 direct interaction direct interaction Fig 2J mcu-7 4 6 unspecified role unspecified role neutral component neutral component purified purified TETSQVAPA tag 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range New protein affinity tag required. binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Extended Data Fig 2i