DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Nature 2018 imex curation Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Accepted 2018-JUL-30 AT 09:14 BST AT 09:14 BST by ORCHARD Nature 2018 imex curation Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Nature 2018 imex curation Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Accepted 2018-JUL-30 AT 09:14 BST AT 09:14 BST by ORCHARD Nature 2018 imex curation Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Nature 2018 imex curation Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Accepted 2018-JUL-30 AT 09:14 BST AT 09:14 BST by ORCHARD Nature 2018 imex curation Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Nature 2018 imex curation Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Accepted 2018-JUL-30 AT 09:14 BST AT 09:14 BST by ORCHARD Nature 2018 imex curation Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Nature 2018 imex curation Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-kidney Mus musculus kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Accepted 2018-JUL-30 AT 09:14 BST AT 09:14 BST by ORCHARD Nature 2018 imex curation Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice. Nature 2018 imex curation Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Accepted 2018-JUL-30 AT 09:14 BST AT 09:14 BST by ORCHARD Nature 2018 imex curation bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10417 original sequence version: 71 DIP protein P10417 original sequence version: 126 80FDCFE78C735092 becn1_mouse Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Becn1 protein protein mouse Mus musculus Mouse MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein O88597 original sequence version: 116 DIP protein O88597 original sequence version: 93 14623BA002E1AAEE becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C bcl2-becn1-12 3 8 unspecified role unspecified role bait bait native native 9 unspecified role unspecified role prey prey native native physical association physical association Fig 1a bcl2-becn1-13 5 8 unspecified role unspecified role bait bait native native 9 unspecified role unspecified role prey prey mutated gene mutated gene O88597:p.Phe121Ala p.Phe121Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 16:27:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe121Ala' physical association physical association Fig 4a,b bcl2-becn1-15 2 8 unspecified role unspecified role bait bait native native 9 unspecified role unspecified role prey prey native native physical association physical association Fig 1a bcl2-becn1-14 4 8 unspecified role unspecified role bait bait native native 9 unspecified role unspecified role prey prey native native physical association physical association Fig 1a bcl2-becn1-16 6 10 unspecified role unspecified role prey prey native native 7 unspecified role unspecified role bait bait native native physical association physical association Extended Data Fig 5 bcl2-becn1-17 1 8 unspecified role unspecified role bait bait native native 9 unspecified role unspecified role prey prey mutated gene mutated gene O88597:p.Phe121Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 15:54:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe121Ala' physical association physical association Extended Data Fig 3a bcl2-becn1-18 5 8 unspecified role unspecified role bait bait native native 9 unspecified role unspecified role prey prey native native physical association physical association Fig 1a