DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane. High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane. Science (New York, N.Y.) 2018 imex curation Srivastava AP., Luo M., Zhou W., Symersky J., Bai D., Chambers MG., Faraldo-Gómez JD., Liao M., Mueller DM. david.mueller@rosalindfranklin.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Srivastava AP., Luo M., Zhou W., Symersky J., Bai D., Chambers MG., Faraldo-Gómez JD., Liao M., Mueller DM. david.mueller@rosalindfranklin.edu Accepted 2019-NOV-20 AT 09:51 GMT AT 09:51 GMT by ORCHARD Science (New York, N.Y.) 2018 imex curation atp14_yeast ATP synthase subunit H, mitochondrial ATP14 L8003.20 YLR295C protein protein yeast Saccharomyces cerevisiae Baker's yeast MFPIASRRILLNASVLPLRLCNRNFTTTRISYNVIQDLYLRELKDTKLAPSTLQDAEGNVKPWNPPQKPNLPELELQGPEALKAYTEQNVETAHVAKESEEGESEPIEEDWLVLDDAEETKESH 7AE196CFB250ACBB atp8_yeast ATP synthase protein 8 ATP8 AAP1 Q0080 A6L ATP-associated protein 1 F-ATPase subunit 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL 7E5483656089A4C2 atpb_yeast ATP synthase subunit beta, mitochondrial ATP2 J2041 YJR121W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLPRLYTATSRAAFKAAKQSAPLLSTSWKRCMASAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN EDFF256826F68F0C EDFF256826F68F0C atpa_yeast ATP synthase subunit alpha, mitochondrial ATP1 YBL0827 YBL099W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLARTAAIRSLSRTLINSTKAARPAAAALASTRRLASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF E8041D289B924696 E8041D289B924696 atp6_yeast ATP synthase subunit a ATP6 OLI2 OLI4 PHO1 F-ATPase protein 6 Q0085 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNLLNTYITSPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH 1A3257747B5A7C57 atpf_yeast ATP synthase subunit 4, mitochondrial ATP4 LPF7C YPL078C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSMSMGVRGLALRSVSKTLFSQGVRCPSMVIGARYMSSTPEKQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSKLK BDBE0F6AD6E5392C BDBE0F6AD6E5392C atpg_yeast ATP synthase subunit gamma, mitochondrial ATP3 YBR039W YBR0408 F-ATPase gamma subunit ATP3a ATP3b protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSRIVSNNATRSVMCHQAQVGILYKTNPVRTYATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG ADC71F3C1E0CDF91 ADC71F3C1E0CDF91 atp5e_yeast ATP synthase subunit epsilon, mitochondrial ATP15 P0345 YPL271W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 0CD754A9DEFFD08C atpk_yeast ATP synthase subunit f, mitochondrial ATP17 D9481.21 YDR377W protein protein yeast Saccharomyces cerevisiae Baker's yeast MIFKRAVSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFHLRHHKGAEEH 3DEF593AE4435551 atp7_yeast ATP synthase subunit d, mitochondrial ATP7 YKL016C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM C6420CBEDF1BB45E C6420CBEDF1BB45E atpd_yeast ATP synthase subunit delta, mitochondrial ATP16 YDL004W YD8119.03 D2935 F-ATPase delta subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRSIIGKSASRSLNFVAKRSYAEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits AE8D0BA364107977 atp18_yeast ATP synthase subunit J, mitochondrial ATPase synthase I subunit YML081BC YML081C-A ATP18 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD F0D7D450C4810025 atpo_yeast ATP synthase subunit 5, mitochondrial Oligomycin sensitivity conferral protein ATP5 YDR298C OSCP D9740.11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNRVFTRSFASSLRAAASKAAAPPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLIVELGDKTVDLSISTKIQKLNKVLEDSI BD5F8EF4503E4D66 BD5F8EF4503E4D66 atp9_yeast ATP synthase subunit 9, mitochondrial OLI1 ATP9 Lipid-binding protein OLI3 Oligomycin resistance protein 1 PHO2 Q0130 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV 82B4477D6F75D758 82B4477D6F75D758 atp14-atp18-1 1 12 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 14 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 10 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 4 unspecified role unspecified role neutral component neutral component purified purified histag histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 3 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 11 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 13 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 2 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 15 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Figure 1 atp1-atp15-1 1 12 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 13 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 3 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 11 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 10 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 15 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Figure 1