UniProt UniProt http://www.uniprot.org Unanticipated functional diversity among the TatA-type components of the Tat protein translocase. Unanticipated functional diversity among the TatA-type components of the Tat protein translocase. Scientific reports 2018 imex curation Eimer E., Kao WC., Fröbel J., Blümmel AS., Hunte C., Müller M. matthias.mueller@biochemie.uni-freiburg.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Eimer E., Kao WC., Fröbel J., Blümmel AS., Hunte C., Müller M. Crosslinking using p-benzoyl-L-phenylalanine and UV irradiation. matthias.mueller@biochemie.uni-freiburg.de Accepted 2018-APR-12 AT 14:45 BST AT 14:45 BST by LIVIAP Scientific reports 2018 Only protein-protein interactions imex curation imex curation Unanticipated functional diversity among the TatA-type components of the Tat protein translocase. Unanticipated functional diversity among the TatA-type components of the Tat protein translocase. Scientific reports 2018 imex curation Eimer E., Kao WC., Fröbel J., Blümmel AS., Hunte C., Müller M. matthias.mueller@biochemie.uni-freiburg.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Eimer E., Kao WC., Fröbel J., Blümmel AS., Hunte C., Müller M. Crosslinking using N,N′-dicyclohexylcarbodiimide matthias.mueller@biochemie.uni-freiburg.de Accepted 2018-APR-12 AT 14:45 BST AT 14:45 BST by LIVIAP Scientific reports 2018 Only protein-protein interactions imex curation imex curation tatb_ecoli Sec-independent protein translocase protein TatB tatB mttA2 ysgB b3838 JW5580 protein protein ecoli Escherichia coli (strain K12) MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKASDEAHTIHNPVVKDNEAAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAPSPSSSDKP DIP protein P69425 original sequence version: 44 31F1405404F5DABF tatc_ecoli Sec-independent protein translocase protein TatC tatC mttB yigU yigV b3839 JW3815 protein protein ecoli Escherichia coli (strain K12) MSVEDTQPLITHLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMIATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGKGRNREEENDAEAESEKTEE DIP protein P69423 original sequence version: 49 D2383F85AF62A81C tata_ecoli Sec-independent protein translocase protein TatA tatA mttA1 yigT b3836 JW3813 protein protein ecoli Escherichia coli (strain K12) MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV 4874F393EFFADC1B tate_ecoli Sec-independent protein translocase protein TatE ybeC tatE b0627 JW0622 protein protein ecoli Escherichia coli (strain K12) MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDDAAAKKGADVDLQAEKLSHKE FA880C6DECE248A3 tatb-tatc-7 2 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) physical association physical association Fig. 6A tatb-tate-1 2 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) physical association physical association Fig. 6A tata-tate-1 2 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) physical association physical association Fig. 6A tatb-tatc-8 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level met-205 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) physical association physical association Fig. 6A tatc-tate-1 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level met-205 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) physical association physical association Fig. 6B tata-tatc-2 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level met-205 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) physical association physical association Fig. 6B