IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. Nucleic acids research 2017 imex curation Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de Accepted 2018-APR-12 AT 07:21 BST AT 07:21 BST by LIVIAP Nucleic acids research 2017 imex curation altered; altered CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. Nucleic acids research 2017 imex curation Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 flp-in Homo sapiens 293 flp-in 293 flp-in anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. Flp-In™ T-Rex™ 293 cells Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de Accepted 2018-APR-12 AT 07:21 BST AT 07:21 BST by LIVIAP Nucleic acids research 2017 imex curation altered; altered CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. Nucleic acids research 2017 imex curation Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 flp-in Homo sapiens 293 flp-in 293 flp-in anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. Flp-In™ T-REx™ 293 cells Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de Accepted 2018-APR-12 AT 07:21 BST AT 07:21 BST by LIVIAP Nucleic acids research 2017 imex curation altered; altered CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality. Nucleic acids research 2017 imex curation Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Hoffmeister H., Fuchs A., Erdel F., Pinz S., Gröbner-Ferreira R., Bruckmann A., Deutzmann R., Schwartz U., Maldonado R., Huber C., Dendorfer AS., Rippe K., Längst G. Results from Figure 4D IPs have not been entered due to lack of antibody specificity. Results from fig 1 D/E are meant negative- not entered (although Supp. Fig 6 A shows 6/8% co-loc). I gave up on trying to enter anything for fig 2 (S7) results. Fig 4D- the antibody is not specific. GBP (GFP Binding Protein) was coupled to a Lac repressor (LacI) in U2OS cells in which an array of Lac operator DNA sequence repeats has been stably integrated into the genome. The GBP–LacI binds to the Lac operator array (LacO). This recruits GFP-labelled proteins to the LacO region within the nucleus. If a second protein labelled with a different fluorescent molecule interacts with the GFP-labelled protein, then it will also display an accumulation at the LacO region. Gernot.Laengst@vkl.uni-regensburg.de,Helen.Hoffmeister@vkl.uni-regensburg.de Accepted 2018-APR-12 AT 07:21 BST AT 07:21 BST by LIVIAP Nucleic acids research 2017 imex curation altered; altered chd4_human Chromodomain-helicase-DNA-binding protein 4 CHD4 ATP-dependent helicase CHD4 Mi-2 autoantigen 218 kDa protein Mi2-beta protein protein human Homo sapiens Human MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESMVTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGGFGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTKKKKKGEEEVTAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQQVAQQQ DIP protein Q14839 original sequence version: 163 DIP protein Q14839 original sequence version: 151 DIP protein Q14839 original sequence version: 114 765ED8485B7BBB85 p66a_human Transcriptional repressor p66-alpha GATA zinc finger domain-containing protein 2A GATAD2A protein protein human Homo sapiens Human MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPTQGLLRATEATAMAMGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGLTTVALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVANVPNTSLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKLALRKQLEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQGRMSAATVLSREPYMCAQCKTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQGTAPAQAKAEPTAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIPQSATWK DIP protein Q86YP4 original sequence version: 114 64F0066B4BEFCB39 cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS DIP protein P45973 original sequence version: 138 DIP protein P45973 original sequence version: 116 DIP protein P45973 original sequence version: 115 DIP protein P45973 original sequence version: 124 DIP protein P45973 original sequence version: 154 DIP protein P45973 original sequence version: 132 DIP protein P45973 original sequence version: 155 16FFC476367093B1 smca4_human Transcription activator BRG1 SMARCA4 BRG1 SNF2B SNF2L4 ATP-dependent helicase SMARCA4 SNF2-beta BAF190A Mitotic growth and transcription activator Protein BRG-1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 Protein brahma homolog 1 BRG1-associated factor 190A protein protein human Homo sapiens Human MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein P51532 original sequence version: 125 DIP protein P51532 original sequence version: 115 DIP protein P51532 original sequence version: 154 DIP protein P51532 original sequence version: 136 DIP protein P51532-1 original sequence version: 136 ABDA5EDBF10D7D28 hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA rbbp4_human Histone-binding protein RBBP4 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 RBBP4 RBAP48 protein protein human Homo sapiens Human MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS DIP protein Q09028 original sequence version: 151 DIP protein Q09028 original sequence version: 111 DIP protein Q09028 original sequence version: 116 DIP protein Q09028-1 original sequence version: 130 DIP protein Q09028 original sequence version: 149 DIP protein Q09028 original sequence version: 159 DIP protein Q09028 original sequence version: 131 B71E2D55A444C360 cbx3_human Chromobox protein homolog 3 CBX3 Heterochromatin protein 1 homolog gamma Modifier 2 protein HECH protein protein human Homo sapiens Human MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ DIP protein Q13185 original sequence version: 147 DIP protein Q13185 original sequence version: 134 DIP protein Q13185 original sequence version: 145 5928C63E0C93A76A cbx1_human Chromobox protein homolog 1 CBX1 CBX Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 p25beta HP1Hsbeta protein protein human Homo sapiens Human MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN DIP protein P83916 original sequence version: 29 DIP protein P83916 original sequence version: 105 DIP protein P83916 original sequence version: 101 BE687AF9C66E48E3 rbbp7_human Histone-binding protein RBBP7 RBBP7 RBAP46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein human Homo sapiens Human MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS DIP protein Q16576 original sequence version: 75 DIP protein Q16576 original sequence version: 136 DIP protein Q16576 original sequence version: 97 DIP protein Q16576 original sequence version: 102 DIP protein Q16576 original sequence version: 145 DIP protein Q16576 original sequence version: 116 DIP protein Q16576 original sequence version: 96 1A4B4CD1A8E96815 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 mta1_human Metastasis-associated protein MTA1 MTA1 protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED DIP protein Q13330 original sequence version: 146 DIP protein Q13330-1 original sequence version: 127 2D5330F0489AE62E chd3_human Chromodomain-helicase-DNA-binding protein 3 ATP-dependent helicase CHD3 Mi-2 autoantigen 240 kDa protein Mi2-alpha Zinc finger helicase CHD3 protein protein human Homo sapiens Human MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLGGKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKVLGCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGEDDGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQSTWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTVKYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYKEGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKGGKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNGYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAIARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEGRRQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWLVRDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKKKVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASATNSPCTSKPATPAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWHRRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD DIP protein Q12873 original sequence version: 136 DIP protein Q12873-1 original sequence version: 124 DIP protein Q12873 original sequence version: 156 DIP protein Q12873 original sequence version: 171 DIP protein Q12873 original sequence version: 108 4494F56E5D0E7083 mta3_human Metastasis-associated protein MTA3 MTA3 KIAA1266 protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIHPAKKPNVIRSTPSLQTPTTKRMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD DIP protein Q9BTC8 original sequence version: 127 E773603F65A16DF1 p66b_human Transcriptional repressor p66-beta GATAD2B KIAA1150 p66/p68 GATA zinc finger domain-containing protein 2B protein protein human Homo sapiens Human MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLVLLKKLRQSQLQKENVVQKTPVVQNAASIVQPSPAHVGQQGLSKLPSRPGAQGVEPQNLRTLQGHSVIRSATNTTLPHMLMSQRVIAPNPAQLQGQRGPPKPGLVRTTTPNMNPAINYQPQSSSSVPCQRTTSSAIYMNLASHIQPGTVNRVSSPLPSPSAMTDAANSQAAAKLALRKQLEKTLLEIPPPKPPAPLLHFLPSAANSEFIYMVGLEEVVQSVIDSQGKSCASLLRVEPFVCAQCRTDFTPHWKQEKNGKILCEQCMTSNQKKALKAEHTNRLKNAFVKALQQEQEIEQRLQQQAALSPTTAPAVSSVSKQETIMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQLSVPGGLLGMPGVNIAYLNTGIGGHKGPSLADRQREYLLDMIPPRSISQSISGQK DIP protein Q8WXI9 original sequence version: 117 DIP protein Q8WXI9 original sequence version: 133 5EB375C7EB24210B mbd3_human Methyl-CpG-binding domain protein 3 MBD3 Methyl-CpG-binding protein MBD3 protein protein human Homo sapiens Human MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV DIP protein O95983 original sequence version: 106 B62134DD1BEB636B mbd2_human Methyl-CpG-binding domain protein 2 MBD2 Methyl-CpG-binding protein MBD2 Demethylase protein protein human Homo sapiens Human MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA FC4E5E0CF9BA0FFA mta2_human Metastasis-associated protein MTA2 MTA2 MTA1L1 PID Metastasis-associated 1-like 1 p53 target protein in deacetylase complex protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED DIP protein O94776 original sequence version: 128 DIP protein O94776 original sequence version: 122 DIP protein O94776 original sequence version: 85 DIP protein O94776 original sequence version: 120 DIP protein O94776 original sequence version: 130 DIP protein O94776 original sequence version: 146 65087AF798BA64EC cdka1_human Cyclin-dependent kinase 2-associated protein 1 Putative oral cancer suppressor Deleted in oral cancer 1 CDK2AP1 CDKAP1 DOC1 protein protein human Homo sapiens Human MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS F3149F72467598C2 smca5_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 SMARCA5 SNF2H WCRF135 Sucrose nonfermenting protein 2 homolog protein protein human Homo sapiens Human MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYREKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL DIP protein O60264 original sequence version: 127 DIP protein O60264 original sequence version: 153 6CC8CB25BAF7A876 1234354tyaqtrseyhs-1 3 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig 1B chd3-hdac1-1 3 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig 1B-2 chd3-hdac1-2 2 18 unspecified role unspecified role prey prey cell lysate cell lysate 13 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 22 unspecified role unspecified role prey prey cell lysate cell lysate 19 unspecified role unspecified role prey prey cell lysate cell lysate 6 unspecified role unspecified role prey prey cell lysate cell lysate 10 unspecified role unspecified role prey prey cell lysate cell lysate 9 unspecified role unspecified role prey prey cell lysate cell lysate 21 unspecified role unspecified role prey prey cell lysate cell lysate 15 unspecified role unspecified role prey prey cell lysate cell lysate association association Fig 1C(Supplementary figure 4) chd4-gatad2a-1 2 18 unspecified role unspecified role prey prey cell lysate cell lysate 13 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 19 unspecified role unspecified role prey prey cell lysate cell lysate 6 unspecified role unspecified role prey prey cell lysate cell lysate 10 unspecified role unspecified role prey prey cell lysate cell lysate 9 unspecified role unspecified role prey prey cell lysate cell lysate 15 unspecified role unspecified role prey prey cell lysate cell lysate 21 unspecified role unspecified role prey prey cell lysate cell lysate 17 unspecified role unspecified role prey prey cell lysate cell lysate association association Fig 1C(Supplementary figure 4)-2 chd3-cdk2ap1-1 2 20 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 17 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 18 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 13 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 22 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 19 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 6 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 10 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 9 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 21 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 15 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep association association Fig 1C(Supplementary figure 4)-3 chd3-cdk2ap1-2 2 20 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 17 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 18 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 13 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 22 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 19 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 6 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 10 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 9 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 21 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 15 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep association association Fig 1C(Supplementary figure 4)-4 chd3-chd4-1 1 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 3 CHD3-GFP and CHD4-GFP exhibited moderate co-localization throughout the entire nucleus;both isoforms were enriched in perinucleolar heterochromatin and depleted in nucleoli, whereas exclusion from nucleoli was particularly pronounced for CHD4-RFP. chd3-hdac1-3 3 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig 4C top chd3-cbx1-1 3 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig 4C top-2 chd3-cbx1-2 2 12 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig 4C bottom chd3-cbx1-3 2 12 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig 4C-2 bottom chd3-chd4-2 4 14 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp Figure 6-1 chd3-chd4-3 4 14 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp Figure 6-2 chd3-hdac1-4 4 13 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp Figure 6-3 chd4-hdac1-4 4 13 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp Figure 6-4 chd3-rbbp7-1 4 21 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp Figure 6-5 chd4-rbbp7-1 4 21 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp Figure 6-6 chd3-hdac1-5 3 23 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp Fig 9 chd3-smarca4-1 3 23 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp Fig 9i chd4-smarca4-1 2 23 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp Fig 9ii chd4-smarca4-2 2 23 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp Fig 9iii