IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. RNA unwinding assay: Brr2 catalyzes the ATP-dependent unwinding of U4/U6 RNA duplices. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay anti tag western anti tag western blot anti tag western Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink ms participant Identification by mass spectrometry ms participant Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. Cross linking agent:BS3 (bis(sulfosuccinimidyl)suberate): an amine-to-amine crosslinker FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. A new role for FBP21 as regulator of Brr2 helicase activity. A new role for FBP21 as regulator of Brr2 helicase activity. Nucleic acids research 2017 imex curation Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de 17-May-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. ( Sorry Livia!) Nasty one this - lots of construct origins unclear and different results obtained with (slightly) different constructs. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Accepted 2018-MAY-09 AT 11:11 BST AT 11:11 BST by LIVIAP Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation I have added mutations back for both. wdr83_human WD repeat domain-containing protein 83 WDR83 MORG1 Mitogen-activated protein kinase organizer 1 protein protein human Homo sapiens Human MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG mint homomint Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator (By similarity). May also be involved in pre-mRNA splicing CF5F59C1FAA432FE u520_human U5 small nuclear ribonucleoprotein 200 kDa helicase SNRNP200 HELIC2 KIAA0788 U5 snRNP-specific 200 kDa protein Activating signal cointegrator 1 complex subunit 3-like 1 BRR2 homolog ASCC3L1 protein protein human Homo sapiens Human MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD 3F3811BDCCC9DDB7 hnrpk_human Heterogeneous nuclear ribonucleoprotein K HNRNPK HNRPK Transformation up-regulated nuclear protein protein protein human Homo sapiens Human METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 0F70EE169B2A064A u6_snrna snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast prp8_yeast Pre-mRNA-splicing factor 8 PRP8 DBF3 DNA39 RNA8 SLT21 USA2 YHR165C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGLPPPPPGFEEDSDLALPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFEINAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLPLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGKALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCIIQNDEEYDTPALFFDPSLNPIPHFIDNNSSLNVSNTKENGDFTLPEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNFLRGTIPLLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTMVKKNLGRLTRLWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVLALEDLKDVYASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSVDPLEKITDAYLDQYLWYEADQRKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFTLLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPANNPNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIGYNNRKCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCGFEVRILPRQRMEEVVSNDEGVWDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAKWNTSLISLFTYFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSWDRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIESVTKETVHPRKSYKMNSSAADITMESVHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQNSMRTIMKANPALYVLRERIRKGLQIYQSSVQEPFLNSSNYAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILTEYGRKYNVNISALTQTEIKDIILGQNIKAPSVKRQKMAELEAARSEKQNDEEAAGASTVMKTKTINAQGEEIVVVASADYESQTFSSKNEWRKSAIANTLLYLRLKNIYVSADDFVEEQNVYVLPKNLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKEIKTVVLVPQLGHVGSVQISNIPDIGDLPDTEGLELLGWIHTQTEELKFMAASEVATHSKLFADKKRDCIDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLLLSDRITGNFIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQFSELAGDEELEAEQIDVFS 8F4F6F89D34D3508 8F4F6F89D34D3508 prp16_human Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 DHX38 DDX38 KIAA0224 PRP16 ATP-dependent RNA helicase DHX38 DEAH box protein 38 protein protein human Homo sapiens Human MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRREREEKDDGEDKKKSKVSSYKDWEESKDDQKDAEEEGGDQAGQNIRKDRHYRSARVETPSHPGGVSEEFWERSRQRERERREHGVYASSKEEKDWKKEKSRDRDYDRKRDRDERDRSRHSSRSERDGGSERSSRRNEPESPRHRPKDAATPSRSTWEEEDSGYGSSRRSQWESPSPTPSYRDSERSHRLSTRDRDRSVRGKYSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREEGEEGISFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSEEMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEELENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL 80D06118D0D465E5 p14678-2 Small nuclear ribonucleoprotein-associated proteins B and B' SNRPB COD SNRPB1 Sm protein B/B' protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL DIP protein P14678-2 original sequence version: 127 DIP protein P14678-2 original sequence version: 136 5CB0BB2E75B93D4A wbp11_human WW domain-binding protein 11 SH3 domain-binding protein SNP70 Npw38-binding protein WBP11 NPWBP SNP70 SIPP1 Splicing factor that interacts with PQBP-1 and PP1 protein protein human Homo sapiens Human MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL C94F9687D132CE77 sf3a1_human Splicing factor 3A subunit 1 Spliceosome-associated protein 114 SF3a120 SF3A1 SAP114 protein protein human Homo sapiens Human MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK DIP protein Q15459 original sequence version: 66 DIP protein Q15459 original sequence version: 158 7259F1EC4577305C zc21a_human Zinc finger C2HC domain-containing protein 1A ZC2HC1A C8orf70 FAM164A CGI-62 protein protein human Homo sapiens Human MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL 8ECAA1FB8B00A8BC wbp4_human WW domain-binding protein 4 WBP4 FBP21 FNBP21 Formin-binding protein 21 WW domain-containing-binding protein 4 protein protein human Homo sapiens Human MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRRTENGKSRNLRQRGDDQ mint A spliceosome-associated protein; may play a role in cross-intron bridging of U1 and U2 snRNPs in the mammalian A complex 7A122A29D4325D11 u4_snrna snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast tia1_human Nucleolysin TIA-1 isoform p40 TIA1 p40-TIA-1 RNA-binding protein TIA-1 T-cell-restricted intracellular antigen-1 protein protein human Homo sapiens Human MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ 4FD2E8B7AF57A0D6 dhx15_human Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 DHX15 DBP1 DDX15 DEAH box protein 15 ATP-dependent RNA helicase #46 protein protein human Homo sapiens Human MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY DIP protein O43143 original sequence version: 101 DIP protein O43143 original sequence version: 157 9A21FBE0051CCAA9 ppih_human Peptidyl-prolyl cis-trans isomerase H U-snRNP-associated cyclophilin SnuCyp-20 Small nuclear ribonucleoprotein particle-specific cyclophilin H PPIH CYP20 CYPH Rotamase H protein protein human Homo sapiens Human MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 566BCE6361E0F339 sf3b2_human Splicing factor 3B subunit 2 SF3B2 SAP145 Pre-mRNA-splicing factor SF3b 145 kDa subunit Spliceosome-associated protein 145 protein protein human Homo sapiens Human MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF D372AFA679443AD6 fa50b_human Protein FAM50B Protein XAP-5-like FAM50B X5L protein protein human Homo sapiens Human MAQYKGTMREAGRAMHLLKKRERQREQMEVLKQRIAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAQREKVKDEEMEVTFSYWDGSGHRRTVRVRKGNTVQQFLKKALQGLRKDFLELRSAGVEQLMFIKEDLILPHYHTFYDFIIARARGKSGPLFSFDVHDDVRLLSDATMEKDESHAGKVVLRSWYEKNKHIFPASRWEAYDPEKKWDKYTIR 9F0653C3D7236997 isy1_human Pre-mRNA-splicing factor ISY1 homolog ISY1 KIAA1160 protein protein human Homo sapiens Human MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY DIP protein Q9ULR0 original sequence version: 99 AB43602EBCB51B2C argl1_human Arginine and glutamate-rich protein 1 ARGLU1 protein protein human Homo sapiens Human MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD 70B88496BF18AAE0 snw1_human SNW domain-containing protein 1 Nuclear protein SkiP Ski-interacting protein Nuclear receptor coactivator NCoA-62 SKIIP SKIP SNW1 protein protein human Homo sapiens Human MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE DIP protein Q13573 original sequence version: 156 0CC75E0D0B2CF842 124436taqetrtu-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 17:18:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Wed May 02 20:17:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 19:19:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:51:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp150ala' Tue Jun 30 16:34:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp150Ala' 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-1 wbp4-snrnp200-2 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:06:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp150ala' Tue Jun 30 19:41:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp150Ala' O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 18:14:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 16:43:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 23 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-3 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-ppih-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Wed May 02 20:21:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp150ala' Tue Jun 30 19:19:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp150Ala' O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:10:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 19:02:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-4 wbp4-sf3b2-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Wed May 02 20:10:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp150ala' Tue Jun 30 17:13:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp150Ala' O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:08:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 16:10:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-5 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-snw1-1 4 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:32:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 16:57:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:09:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp150ala' Tue Jun 30 18:26:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp150Ala' physical association physical association Table 1-6 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-wdr83-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:37:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 17:18:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Wed May 02 14:39:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp150ala' Tue Jun 30 18:10:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp150Ala' 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-7 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-zc2hc1a-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:28:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 20:17:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Wed May 02 17:59:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp150ala' Tue Jun 30 19:01:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp150Ala' 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-8 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-fam50b-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-9 wbp4-tia1-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:17:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 16:47:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-10 wbp4-zc2hc1a-2 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 18:42:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 18:05:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-11 wbp4-hnrnpk-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:56:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 19:32:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 26 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-12 wbp4-isy1-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:57:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 17:59:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-13 wbp4-wbp11-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 18:32:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 16:40:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-14 wbp4-sf3a1-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 18:54:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 19:43:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-15 wbp4-dhx38-1 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:00:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp191ala' Tue Jun 30 17:41:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp191Ala' 22 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1-16 wbp4-snrnp200-1 6 19 unspecified role unspecified role neutral component neutral component purified purified lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys286 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys274 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys284 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys286 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys250 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys270 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys274 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys284 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys286 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys365 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys107 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1567 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1603 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1711 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1841 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys2080 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys2087 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1567 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys1567 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 100 116 102 124 119 103 104 118 105 117 106 126 120 107 125 108 123 109 110 121 111 128 129 112 113 127 114 122 physical association physical association Figure 1 The cross-link between FBP21 K338 and Brr2 K1874 was the predominant site. wbp4-snrnp200-3 1 19 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 2A snrnp200-wbp4-1 1 19 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O75554:p.[Lys357Glu;Arg359Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:01:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys357glu,arg359glu' Tue Jun 30 15:55:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys357Glu;Arg359Glu]' ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 2B, 3C, Supp. figure 2/3/4 Binding of FBP21_276-376 and FBP21_326-376 induced similar chemical shift changes. snrnp200-wbp4-2 5 19 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 3A, Supp 11 A/C/D Kds added on each construct of FBP21 Kd values obtained for the interaction of FBP21_116–376 with Brr2 in both presence and absence of SmB-peptide were similar. snrnp200-wbp4-3 1 19 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region_peptide57 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminal_region_peptide58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 3C, Supp.Fig 7 Binding of peptide 58 to Brr2C-Sec63 induced chemical shift changes that were intermediate between peptide 57 and FBP21276–376 in number and magnitude. snrnp200-wbp4-4 5 19 unspecified role unspecified role neutral component neutral component purified purified O75554:p.[Lys357Glu;Arg359Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain R E Wed May 02 20:04:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys357glu,arg359glu' Tue Jun 30 18:57:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys357Glu;Arg359Glu]' c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O75554:p.[Lys358Ala;Arg360Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:38:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys358ala,arg360ala' Tue Jun 30 18:26:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys358Ala;Arg360Ala]' ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 3A-3 Kds added on each construct of FBP21 snrnp200-wbp4-5 3 19 unspecified role unspecified role prey prey purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 3B I could have added a "binding Region" of 1325-2129..2136? -did not. Full length Brr2 reacted weakly. snrnp200-wbp4-6 3 19 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 3B-2 1234345qw3rwety-1 2 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 20 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 enzyme enzyme neutral component neutral component purified purified nc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction Figure 4A The unwinding activity of full length and Brr2NC was unchanged upon addition of FBP21 200–376. snrnp200-u4_snrna-1 2 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 20 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction Figure 4A-2 snrnp200-u4_snrna-2 2 19 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 20 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction Figure 4A-3, 4D, supp fig 10-A FBP21 200–376 caused the apparent unwinding rate of Brr2_HR to be reduced nearly by half. snrnp200-u4_snrna-3 8 19 unspecified role unspecified role neutral component neutral component purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 20 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association Figure 4B, Supp fig 9. u4_snrna-u6_snrna-1 8 19 unspecified role unspecified role neutral component neutral component purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 4B, Supp fig 9.-2 snrnp200-u4_snrna-4 8 19 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 20 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Figure 4C-2 FBP21 200–376 inhibits RNA binding of Brr2HR when present in high concentrations. Inhibition is reduced when the shorter FBP21 276–376 is used. FBP21 200–376 inhibits RNA binding of Brr2HR when present in high concentrations. Kd given for the interaction in the presence of 5uM FBP21 200-376 (163nM). When the shorter FBP21 276–376 was used, a Kd of 43nM was obtained. snrnp200-u4_snrna-5 8 12 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 20 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Figure 4C-1 snrnp200-u4_snrna-6 8 19 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 20 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Figure 4C-3 FBP21 200–376 inhibits RNA binding of Brr2HR when present in high concentrations. Inhibition is reduced when the shorter FBP21 276–376 is used. Kd for the interaction in the presence of 5uM FBP21 200-376 was 163nM. When the shorter FBP21 276–376 was used, a Kd of 43nM was obtained. snrnp200-u4_snrna-7 2 19 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 20 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction Figure 4E/F, supp fig 10-B FBP21 276–376 reduced the unwinding rate of Brr2-HR approximately two-fold, similar to FBP21 200–376. However, experiments employing high concentrations of FBP21 276–376 revealed the same reduction in unwinding rate, but no decrease in the unwound fraction. FBP21 326–376 has no inhibitory effect on Brr2-HR I could add FBP21 aas 276-325 as a "binding region" - but not quite sure if that is appropriate here.(just left a comment) snrnp200-u4_snrna-8 2 13 stimulator stimulator neutral component neutral component purified purified Jab1_deltaC_construct sufficient to bind sufficient binding region sufficient to bind range range range range 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 20 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction Figure 4G-1 prp8-snrnp200-1 2 19 inhibitor inhibitor neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 stimulator stimulator neutral component neutral component purified purified Jab1_deltaC_construct sufficient to bind sufficient binding region sufficient to bind range range range range 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 20 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction Figure 4G-2 The activatory effect of Prp8Jab1_delta_C is completely abolished in presence of FBP21_200–376. 1346-1 7 19 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Supp figure 1A-E snrnp200-wbp4-7 7 19 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified Jab1_deltaC_construct sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Supp figure 1F/G Size exclusion chromatography revealed that FBP21_276–376 can bind simultaneously with Prp8Jab1_delta_C to Brr2-HR Size exclusion chromatography revealed that FBP21_276–376 can bind simultaneously with Prp8Jab1_delta_C to Brr2-HR. snrnp200-wbp4-8 5 19 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region_peptide57 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminal_region_peptide58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminal_peptide_fkkrr sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O75554:p.Phe356_Arg360delinsLysArgPheArgLys mutation mutation certain certain sequence position certain certain certain sequence position certain FKKRR KRFRK Thu Apr 12 11:34:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_lys_lys356-358lys_arg_phe,arg360lys' Wed May 02 17:52:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_lys_lys_arg_arg356-360lys_arg_phe_arg_lys' Tue Jun 30 16:45:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe356_Arg360delinsLysArgPheArgLys' O75554:p.Phe356_Arg360delinsGlyLysLysArgArg mutation mutation certain certain sequence position certain certain certain sequence position certain FKKRR GKKRR Thu Apr 12 11:15:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe356gly,lys,lys,arg,arg' Wed May 02 19:24:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_lys_lys_arg_arg356-360gly_lys_lys_arg_arg' Tue Jun 30 18:14:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe356_Arg360delinsGlyLysLysArgArg' chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Supp. Fig 6, Fig. 3A The mutated peptides GKKRR and KRFRK give a Kd of 37 and 27 uM respectively. Not sure if I have entered the mutated peptides (Supp fig 6) correctly:- So have entered as a) comment only.b) in the form:-phe356gly,lys,lys,arg,arg snrnp200-wbp4-9 5 19 unspecified role unspecified role neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp Fig 11 B/D/EF Brr2C-Sec63 itself did not interact with the SmB-peptide. The Kd values obtained in both presence and absence of Brr2C-Sec63 were similar. snrnp200-u4_snrna-9 2 19 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro 20 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro atpase reaction atpase reaction Supp fig 11 G/H FBP21_116–376 inhibited the Brr2HR helicase activity to a similar extent as FBP21_200–376.