UniProt UniProt http://www.uniprot.org IL-17 is a neuromodulator of Caenorhabditis elegans sensory responses. IL-17 is a neuromodulator of Caenorhabditis elegans sensory responses. Nature 2017 imex curation Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk Accepted 2018-JUL-16 AT 07:54 BST AT 07:54 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation IL-17 is a neuromodulator of Caenorhabditis elegans sensory responses. IL-17 is a neuromodulator of Caenorhabditis elegans sensory responses. Nature 2017 imex curation Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk Accepted 2018-JUL-16 AT 07:54 BST AT 07:54 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation IL-17 is a neuromodulator of Caenorhabditis elegans sensory responses. IL-17 is a neuromodulator of Caenorhabditis elegans sensory responses. Nature 2017 imex curation Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. comigration in sds comigration in sds page comigration in sds anti tag western anti tag western blot anti tag western Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk Accepted 2018-JUL-16 AT 07:54 BST AT 07:54 BST by PPORRAS Nature 2017 Only protein-protein interactions imex curation imex curation ilcr1_caeel Interleukin cytokine receptor-related protein 1 Interleukin-17 receptor-like protein 1 Y64G10A.6 ilcr-1 protein protein caeel Caenorhabditis elegans MFLHSPALLIWLFLFCLAGPQAVRTEPYNSTSSSSSPTANDVTSSDLLLLASEETPTRAPKPVTKQGKKNVVKVKKGGNGTVDDSPWVTDCSEPLNKDISCSVNIIGCSDNVFKYVDAGQEPPRAHDVRIAPTTKVMGANRIDKRKHRLHVDVSWQIPQLEASTHLKAFKLIVNGPDGKNTCFVFNVTQTHVDDEGISPRYRFSSNTLFDFGHNYTVTIVSLPMSRKRAPKVSATSLMPDDPDAAPVKIVKTNEQMCEGKSNPQASKWAASFRKIFLFSAIRLIQIEFLAAPPQYCFEEYEVRLLDSSGIVMLQSAIITKDELRTEIINGRPVQFGEFNFTDIELDTDLIPSVIPIESAHDGRCLCVTENGCSCLAADWKPVKLTRIEKPPATSNQTEESDGKAEKDKKEDTTWTWHTYAITGGAIIAILFILSVCAGLKCYKKFNNKKKASNIHLLNENPAFSHSGSIPLILKQSISVLIVYSHDSAQHEAAVLAFAELLRDVFNLNVHLDVWDEDDIEENRAEYINSSIVRANKVIIINSIGAYFRTVFRHQREPAIERITTGRNDVIFDMQCELALQHPCVISCHFSYTNPKYVFFPINRLLQYSIPNSLMTMTTALTEQPARPEQLAGFNQVFARLQAAISRKLNYIESDPQWFENTHHRVATRRVSELEAHNIVPLPPSLEVKVEDEDAFGQMETLPIDELKEKFAAKRDLEVEVLDSEDVKLLEDVKCAPGPIHVEPTEPEVLEPAEEPMEEAEEDEEDEDDVDSVEGQTARIEELQRLIVHKDMNHDSGNLDSAYVSGSDFSADIHNEILDKPRLNAEMDLRKANREDSAFHDEVIGIH 613AEF55EBB89EA4 actl1_caeel ACT1-like protein actl-1 C15B12.6 protein protein caeel Caenorhabditis elegans MTKMKMDVTIELDLDGDDWEEVDVLSDKCVEDILEDVHIDDPILVSDVRITLPANIRIKNFKKEIRDLILANLDVPTTVSAGSWQIVSSFLRGIEYSEIGGRERNSKLSWKPFEDMHAQILVNALAYAQRVDILVKLKSYIDSNSYLKNVPEPMFAFADTDSMASTTTFSEYAEPVHSMNARKKILLLHYETTSKEKEDFKWFKCNLKNVLEKERKEGKDLEVFDVKVWEKDDRGNVFQELEKHYDLFPHIVVCFNKSYIEATKPNSKSKMPQFRKSISDKLNVEFHMNGNRNLRGRCVLMSEVEKVTDTYWAAVTNQYPFPGSFEPFVKRLLRDGKVKKQSHNNANDHHEDSMNYSITQ F8593B9CD6DC335D ilcr2_caeel Interleukin cytokine receptor-related protein 2 ilcr-2 Interleukin-17 receptor-like protein 2 F56D1.2 protein protein caeel Caenorhabditis elegans MVRLCTTNFLAYRATGSPLLLLYFYLCSLSSVKSSAAASYTNASDYVLRNVFEHSDQCYKDSFVYVRADDKKSDPFITYSTTKECSERLKKNDLPEKLPTCPPGLIDLELKPVYVPKSQISYPYANLNISVTAHSSVDTIAFRLECLSASDGSDVYCSNSKAMYINGVKEWPCRGIHLSSRVQYPTRFSYSCFRLTSFSVYAINATILPQKCRVSTIMTAPYFDDMFPEILVDPTTNQSIITKTDPFWAPMLSADFSDKNAIWVRLGKAERAECETMVVNVYKEHDDDSQKVTFLEILTVKCPETAVKWENQKAGRYLLTAYVPIRGCKFYCEKKERGCRQCLRTHLNLVIYKNRASLSWLALQKFKDYGFEIFIAVVVLLILIIVLAVTGFGYVLWRDKVRSREVRNIALTEFVKVMIVYADDNDLHTDCVKKLVENLRNCASCDPVFDLEKLITAEQIVPSRWLVDQISSLKKFIIVVSDCAEKILDTEASETHQLVQARPFADLFGPAMEMIIRDATHNFPEARKKYAVVRFNYSPHVPPNLAILNLPTFILPEQFAQLTAFLHNVEHTERANVTQNISEAQIHEWNLCASRMMSFFVRNPNWLETRWKPKDELAALHLKRQSPVIVPIQTEEDRIAASIKYNLVPPQALVDSDDEDDVDLQPHASHQNQPLILLPPEQCGPDSDSDSESDSSSESESESDNEGEDPKTIVVKKS 42B9E056288417AA il171_caeel Interleukin cytokine-related protein 17.1 Interleukin 17 cytokine-related protein 1 T22H6.1 ilc-17.1 protein protein caeel Caenorhabditis elegans MPKSPHRTNLQSFYPIMIILTHLALDSNCWRIRREVDGEEEDIMPSEECYHKYNEENHFKVFSNYLNRKNSSHYSPIAPSYQQALLRLQVKGLKHGEQITKSSGKCNSKKLDTISAETPLRDRALCKFEYVLNYNPKRLPAALTEVKCSCPRPNSKLVGKRIFECEHLRYQVRVLMWDDSCNTFREHVETIALACIPVIQANANADGDDDFIYTIKAEIPI AF35CFBB09AB6B95 pik1_caeel Pelle-like serine/threonine-protein kinase pik-1 pik-1 K09B11.1 protein protein caeel Caenorhabditis elegans MDDSLGVSEVVMIPFMKREVLQQICAILDTDNTWETIAPYMPGIELRDVEGCKRYSSYNQSPSELLLRIWSSKGYSTTHLYQLFAKTKLIRLMRMMRSQVHEKYHYLENKVTNSTSRVSKQMVQPPGSQSASRLKKTEIKESSPSPAAAAASQLSRSNTDDTLRVAIEGTLPVTYCELLEATNGFAVSNVIGKGGYGTVYKGELKGTGGIVAVKRLHSGNDTSQNGSRERLRQSLTELRTLARFRHDNILPIYAYSLEGSEPCLVYQFMSNGSLEDRLLCRKGSVPLTWIQRKEISIGAGRGLGFLHSFGKTPIIHGDIKTANILLDKHMEPKIGDFGLCRDGHVEAEAMEKHPLIASHIKGTLAYLAPEFITSKILTTKLDVYSFGIVLLEIASGQRAYSDSRETRGLVEYCQVNKELAAHRKIPVREIFIDRRAPPLVGDEEKSFLDALIEVGLAGANNDRKVRPTMSQIVEYLCKNSIPPVV 3A83F59848F0EF2A ilcr_1-yso2_caeel-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C ILCR-1-GFP specifically co-precipitated with ILCR-2-HA yso2_caeel-ilcr_1-1 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C ILCR-1-GFP specifically co-precipitated with ILCR-2-HA ilcr_1-yso2_caeel-2 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1B GFP-tagged ILCR-1 co-localized with HA-tagged ILCR-2 at the plasma membrane of HEK293T cells (Fig. 1b), ilc_17.1-1 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Extended Fig. 1H Like mammalian IL-17s, ILC-17.1 formed disulfide-linked dimers15 (Extended data Fig.1h). In the presence of 100mM dithiothreotol, the protein becomes monomeric, suggesting ILC-17.1 forms disulfide-linked dimers. ilcr_1-actl_1-1 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5A actl_1-yso2_caeel-1 1 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5B actl_1-pik_1-1 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5D PIK-1-FLAG and ACTL-1-HA co-expressed in HEK cells formed a complex (Fig. 5c, d), suggesting these two proteins interact physically. pik_1-actl_1-1 1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5C PIK-1-FLAG and ACTL-1-HA co-expressed in HEK cells formed a complex (Fig. 5c, d), suggesting these two proteins interact physically. ilcr_1-actl_1-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5A actl_1-ilcr_1-1 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5B