UniProt UniProt http://www.uniprot.org Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Biochimica et biophysica acta. Molecular basis of disease 2017 imex curation Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Accepted 2019-MAY-02 AT 12:52 BST AT 12:52 BST by MGT Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Biochimica et biophysica acta. Molecular basis of disease 2017 imex curation Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Accepted 2019-MAY-02 AT 12:52 BST AT 12:52 BST by MGT Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Biochimica et biophysica acta. Molecular basis of disease 2017 imex curation Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Accepted 2019-MAY-02 AT 12:52 BST AT 12:52 BST by MGT Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Challenging drug target for Parkinson's disease: Pathological complex of the chameleon TPPP/p25 and alpha-synuclein proteins. Biochimica et biophysica acta. Molecular basis of disease 2017 imex curation Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Accepted 2019-MAY-02 AT 12:52 BST AT 12:52 BST by MGT Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 tppp_human Tubulin polymerization-promoting protein TPPP TPPP1 25 kDa brain-specific protein TPPP/p25 p24 p25-alpha protein protein human Homo sapiens Human MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK F8B2C814EA59129A snca-tppp-1 3 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3 snca-tppp-2 4 5 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 4B snca-tppp-3 1 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 4C tppp-snca-1 4 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 7A tppp-snca-2 4 6 competitor competitor competitor prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 7 Multiple deletions are needed to eliminate the interaction of TPPP/p25 with SYN. snca-tppp-4 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component purified purified n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 8B snca-tppp-5 2 6 competitor competitor competitor neutral component neutral component purified purified 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 8B/C