IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Methyl-CpG-binding protein MBD2 plays a key role in maintenance and spread of DNA methylation at CpG islands and shores in cancer. Methyl-CpG-binding protein MBD2 plays a key role in maintenance and spread of DNA methylation at CpG islands and shores in cancer. Oncogene 2017 imex curation Stirzaker C., Song JZ., Ng W., Du Q., Armstrong NJ., Locke WJ., Statham AL., French H., Pidsley R., Valdes-Mora F., Zotenko E., Clark SJ. s.clark@garvan.org.a 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Stirzaker C., Song JZ., Ng W., Du Q., Armstrong NJ., Locke WJ., Statham AL., French H., Pidsley R., Valdes-Mora F., Zotenko E., Clark SJ. s.clark@garvan.org.a Accepted 2018-MAR-14 AT 16:59 GMT AT 16:59 GMT by LIVIAP Oncogene 2017 Only protein-protein interactions imex curation imex curation Methyl-CpG-binding protein MBD2 plays a key role in maintenance and spread of DNA methylation at CpG islands and shores in cancer. Methyl-CpG-binding protein MBD2 plays a key role in maintenance and spread of DNA methylation at CpG islands and shores in cancer. Oncogene 2017 imex curation Stirzaker C., Song JZ., Ng W., Du Q., Armstrong NJ., Locke WJ., Statham AL., French H., Pidsley R., Valdes-Mora F., Zotenko E., Clark SJ. s.clark@garvan.org.a 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Stirzaker C., Song JZ., Ng W., Du Q., Armstrong NJ., Locke WJ., Statham AL., French H., Pidsley R., Valdes-Mora F., Zotenko E., Clark SJ. The protein MBD2b is a hypothetical N-terminally truncated form of the full length protein MBD2a;however it's existence has not been proven by supporting cDNA sequences. Cross linking agent - Formaldehyde s.clark@garvan.org.a Accepted 2018-MAR-14 AT 16:59 GMT AT 16:59 GMT by LIVIAP Oncogene 2017 Only protein-protein interactions imex curation imex curation Methyl-CpG-binding protein MBD2 plays a key role in maintenance and spread of DNA methylation at CpG islands and shores in cancer. Methyl-CpG-binding protein MBD2 plays a key role in maintenance and spread of DNA methylation at CpG islands and shores in cancer. Oncogene 2017 imex curation Stirzaker C., Song JZ., Ng W., Du Q., Armstrong NJ., Locke WJ., Statham AL., French H., Pidsley R., Valdes-Mora F., Zotenko E., Clark SJ. s.clark@garvan.org.a 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stirzaker C., Song JZ., Ng W., Du Q., Armstrong NJ., Locke WJ., Statham AL., French H., Pidsley R., Valdes-Mora F., Zotenko E., Clark SJ. The protein MBD2b is a hypothetical N-terminally truncated form of the full length protein MBD2a;however it's existence has not been proven by supporting cDNA sequences. s.clark@garvan.org.a Accepted 2018-MAR-14 AT 16:59 GMT AT 16:59 GMT by LIVIAP Oncogene 2017 Only protein-protein interactions imex curation imex curation borg2_human_gene Cdc42 effector protein 3 CDC42EP3 BORG2 CEP3 gene gene human Homo sapiens Human tesk2_human_gene Dual specificity testis-specific protein kinase 2 TESK2 gene gene human Homo sapiens Human oat_human_gene Ornithine aminotransferase, mitochondrial OAT gene gene human Homo sapiens Human hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 dnmt1_human DNA (cytosine-5)-methyltransferase 1 CXXC9 MCMT DNA methyltransferase HsaI CXXC-type zinc finger protein 9 DNMT1 AIM DNMT protein protein human Homo sapiens Human MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD DIP protein P26358 original sequence version: 171 DIP protein P26358-1 original sequence version: 121 DIP protein P26358 original sequence version: 121 DIP protein P26358-1 original sequence version: 128 DIP protein P26358 original sequence version: 128 1E833192D22AFA5B assy_human_gene Argininosuccinate synthase ASS1 ASS gene gene human Homo sapiens Human mbd2_human Methyl-CpG-binding domain protein 2 MBD2 Methyl-CpG-binding protein MBD2 Demethylase protein protein human Homo sapiens Human MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA FC4E5E0CF9BA0FFA lhx8_human_gene LIM/homeobox protein Lhx8 LHX8 gene gene human Homo sapiens Human barh2_human_gene BarH-like 2 homeobox protein BARHL2 gene gene human Homo sapiens Human sgk2_human_gene Serine/threonine-protein kinase Sgk2 SGK2 gene gene human Homo sapiens Human 12345qert-1 3 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 3A mbd2-dnmt1-1 2 8 unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep 7 unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep 10 unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep association association Figure 3B/D mbd2-dnmt1-2 3 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 3C mbd2-ass1-1 1 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level hypomethylated_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4B-1 Average methylation levels detected in the MBD2-KD clones were significantly reduced. There was a reduction in direct binding of MBD2 to the hypomethylated loci (ASS1, SGK2, BARHL2, LHX8, TESK2, CDC42EP3 and OAT) in the MBD2-KD clones. mbd2-ass1-2 1 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level hypomethylated_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4B-2 Average methylation levels detected in the MBD2-KD clones were significantly reduced. There was a reduction in direct binding of MBD2 to the hypomethylated loci (ASS1, SGK2, BARHL2, LHX8, TESK2, CDC42EP3 and OAT) in the MBD2-KD clones. mbd2-sgk2-1 1 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level hypomethylated_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4B-3 Average methylation levels detected in the MBD2-KD clones were significantly reduced. There was a reduction in direct binding of MBD2 to the hypomethylated loci (ASS1, SGK2, BARHL2, LHX8, TESK2, CDC42EP3 and OAT) in the MBD2-KD clones. mbd2-sgk2-2 1 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level hypomethylated_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4B-4 Average methylation levels detected in the MBD2-KD clones were significantly reduced. There was a reduction in direct binding of MBD2 to the hypomethylated loci (ASS1, SGK2, BARHL2, LHX8, TESK2, CDC42EP3 and OAT) in the MBD2-KD clones. mbd2-lhx8-1 1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level hypomethylated_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4B-5 Average methylation levels detected in the MBD2-KD clones were significantly reduced. There was a reduction in direct binding of MBD2 to the hypomethylated loci (ASS1, SGK2, BARHL2, LHX8, TESK2, CDC42EP3 and OAT) in the MBD2-KD clones. mbd2-cdc42ep3-1 1 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level hypomethylated_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4B-6 Average methylation levels detected in the MBD2-KD clones were significantly reduced. There was a reduction in direct binding of MBD2 to the hypomethylated loci (ASS1, SGK2, BARHL2, LHX8, TESK2, CDC42EP3 and OAT) in the MBD2-KD clones. mbd2-oat-1 1 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level hypomethylated_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4B-7 Average methylation levels detected in the MBD2-KD clones were significantly reduced. There was a reduction in direct binding of MBD2 to the hypomethylated loci (ASS1, SGK2, BARHL2, LHX8, TESK2, CDC42EP3 and OAT) in the MBD2-KD clones.