UniProt UniProt http://www.uniprot.org CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. EMBO molecular medicine 2016 imex curation Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. paquis@hermes.unice.fr 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr Accepted 2018-JAN-17 AT 09:38 GMT AT 09:38 GMT by MGT EMBO molecular medicine 2016 imex curation CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. EMBO molecular medicine 2016 imex curation Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. paquis@hermes.unice.fr 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. paquis@hermes.unice.fr Accepted 2018-JAN-17 AT 09:38 GMT AT 09:38 GMT by MGT EMBO molecular medicine 2016 imex curation CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. EMBO molecular medicine 2016 imex curation Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. paquis@hermes.unice.fr 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr Accepted 2018-JAN-17 AT 09:38 GMT AT 09:38 GMT by MGT EMBO molecular medicine 2016 imex curation CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. EMBO molecular medicine 2016 imex curation Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. paquis@hermes.unice.fr 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr Accepted 2018-JAN-17 AT 09:38 GMT AT 09:38 GMT by MGT EMBO molecular medicine 2016 imex curation CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. CHCHD10 mutations promote loss of mitochondrial cristae junctions with impaired mitochondrial genome maintenance and inhibition of apoptosis. EMBO molecular medicine 2016 imex curation Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. paquis@hermes.unice.fr 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr Accepted 2018-JAN-17 AT 09:38 GMT AT 09:38 GMT by MGT EMBO molecular medicine 2016 imex curation mic25_human MICOS complex subunit MIC25 CHCHD6 CHCM1 Coiled-coil-helix cristae morphology protein 1 Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 MIC25 protein protein human Homo sapiens Human MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARELESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRDRPHEVLLCSDLVKAYQRCVSAAHKG 674DE387557AF4F0 mic60_mouse MICOS complex subunit Mic60 Mitofilin Immt Mic60 Mitochondrial inner membrane protein protein protein mouse Mus musculus Mouse MLRACQLSGVTVAAQSCLCGKFVLRPLRPCRRYSTSSSSGLTAGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFGMVLGSAPYTVPLPKKPVQSGPLKISSVSEVMKDSKLPVAQSQKTKGDTPASAASTGAAQIISAAGDTLSVPAPAVQHEDTIKTECPNTNEGKSTSETTEEAFSSSVRERPPEEVAARLAQQEKQEQVEMESLAKSLEDALNRTSSVTLQTITAQNAAVQAVKAHSNILKTAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKEELEKMKTIIEDAKKREIAGATPHITAAEGRLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFRKELDSITPDITPGWKGMSISDLAGKLSTDDLNSLIAHAHRRIDQLNRELAQQKATEKQHIELALEKHKLEEKRTFDSAVAKALEHHRSEIQAEQDRKVEEVRDAMENEMRTQLRRQAAAHTDHLRDVLKVQEQELKYEFEQGLSEKLSEQELEFRRRSQEQMDSFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAEMPTIPLGSAVEAIRVNCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPKQLKPPAELYPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQQE DIP protein Q8CAQ8 original sequence version: 73 5EB37BCA054BD7A6 mic60_human MICOS complex subunit MIC60 Mitofilin p87/89 Cell proliferation-inducing gene 4/52 protein MIC60 IMMT HMP MINOS2 Mitochondrial inner membrane protein PIG4 PIG52 protein protein human Homo sapiens Human MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKEELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELAEQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMRTQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIKANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE 357F25DCABB02E50 mic19_mouse MICOS complex subunit Mic19 Chchd3 Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 Mic19 protein protein mouse Mus musculus Mouse MGGTASTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSSVYGASVSDEDLKRRVAEELALEQAKKESEHQRRLKQARDLERERAAANEQLTRAVLRERISSEEERMKAKHLARQLEEKDRVMRKQDAFYKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKFKRYEYHPVCADLQTKILQCYRQNTQQTLSCSALASQYMHCVNHAKQSMLEKGG 055B1AF5A6DB808E mic25_mouse MICOS complex subunit Mic25 Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 Mic25 Chchd6 protein protein mouse Mus musculus Mouse MGSAESAEARRVSFEMDEEERVRVLQGIRLSESVVNRMKDCSQPSAGEQLVPGFGPSSSAPVPTVPLPAISVPTVPAPTTPVPTAPSSSVRGLPGGTCKGPLTDVKVPSAESGGGLQSSAVKEDLKKFQQEQLAVQDEMVRVAKKEKEAAEKHLKASLPKKKASLTHEQQQSARLARELEDREAELSRRDTFYKEQQGRIQEKNAELYKLSSQQFHEAASKAESTIKPRRVEPVCSGLQAQILRCYRDHLHEVLLCSDLVKAYQHCVSTARKG 4A6345E4B17B0DDE chc10_human Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial Protein N27C7-4 CHCHD10 C22orf16 protein protein human Homo sapiens Human MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP A3AA3894CBEC0137 mic19_human MICOS complex subunit MIC19 CHCHD3 MINOS3 Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 MIC19 protein protein human Homo sapiens Human MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAKELDRERAAANEQLTRAILRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFYRVTTEQYQKAAEEVEAKFKRYESHPVCADLQAKILQCYRENTHQTLKCSALATQYMHCVNHAKQSMLEKGG 569E405EB7C801D0 q7tnl9_mouse Chchd10 Ndg2 protein protein mouse Mus musculus Mouse MPRGSRSAAARPVSRPAPPPAHPPPSAAAPAPAAPGQPGLMAQMASTAAGVAVGSAVGHVMGSALTSAFSGGNSEPAQPAVQQAPARPASHPLQMGPCSYEIKQFLDCSTTQSDLTLCEGFSEALKQCKYNHGLSSLP 7FDC9BC7EBE90CF2 chchd10-chchd6-1 3 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association Fig. 1A chchd10-chchd3-1 1 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association Fig. 1C chchd10-chchd3-2 4 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous association association Fig. 2A immt-chchd10-1 5 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association Fig. 2A In reverse experiment, mitofilin was immunoprecipitated by a rabbit polyclonal anti‐CHCHD10 antibody in HeLa cells (Fig 2A). chchd10-immt-1 2 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction Fig. 2B Last, we used a proximity ligation assay (PLA Duolink) to analyze in situ the proximity between CHCHD10 and mitofilin comparing control and patient fibroblasts. chchd10-chchd6-2 2 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction Fig. 2B