IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Negative regulation of syntaxin4/SNAP-23/VAMP2-mediated membrane fusion by Munc18c in vitro. Negative regulation of syntaxin4/SNAP-23/VAMP2-mediated membrane fusion by Munc18c in vitro. PloS one 2007 imex curation Brandie FM., Aran V., Verma A., McNew JA., Bryant NJ., Gould GW. G.Gould@bio.gla.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Brandie FM., Aran V., Verma A., McNew JA., Bryant NJ., Gould GW. Origin species of Munc18 has been inferred to be mouse given evidence in ref: 21548926 (Same corresponding author, same plasmid, same tag and same protein name) Munc18C detected by MS to be mouse (See Supplementary material). G.Gould@bio.gla.ac.uk Accepted 2018-OCT-01 AT 15:56 BST AT 15:56 BST by PPORRAS PloS one 2007 Only protein-protein interactions imex curation imex curation Negative regulation of syntaxin4/SNAP-23/VAMP2-mediated membrane fusion by Munc18c in vitro. Negative regulation of syntaxin4/SNAP-23/VAMP2-mediated membrane fusion by Munc18c in vitro. PloS one 2007 imex curation Brandie FM., Aran V., Verma A., McNew JA., Bryant NJ., Gould GW. G.Gould@bio.gla.ac.uk 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Brandie FM., Aran V., Verma A., McNew JA., Bryant NJ., Gould GW. Origin species of Munc18 has been inferred to be mouse given evidence in ref: 21548926 (Same corresponding author, same plasmid, same tag and same protein name) Munc18C detected by MS to be mouse (See Supplementary material). G.Gould@bio.gla.ac.uk Accepted 2018-OCT-01 AT 15:56 BST AT 15:56 BST by PPORRAS PloS one 2007 Only protein-protein interactions imex curation imex curation stxb3_mouse Syntaxin-binding protein 3 Stxbp3 Stxbp3a Unc18c Protein unc-18 homolog 3 Protein unc-18 homolog C Mammalian homolog of Unc-18c MUNC-18-3 protein protein mouse Mus musculus Mouse MAPPVSERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSRCPAVWNGSGAVSARQKPRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKDKVSFKDE mint 7874B71DE107871A stx4_rat Syntaxin-4 Stx4 Stx4a protein protein rat Rattus norvegicus (Rat) Rat MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLSSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVSVTVLILAVIIGITITVG E98547758FE6CEC6 vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63045 original sequence version: 95 DIP protein P63045 original sequence version: 90 DIP protein P63045 original sequence version: 64 DIP protein P63045 original sequence version: 62 DIP protein P63045 original sequence version: 85 DIP protein P63045 original sequence version: 104 DIP protein P63045 original sequence version: 77 DIP protein P63045 original sequence version: 75 DIP protein P63045 original sequence version: 106 4A0D0D56B5409D0A sx4_munc18-1 1 3 unspecified role unspecified role prey prey purified purified His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli-m15 Escherichia coli M15 4 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range cytosolic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-20560279]The shifted ranges (1-273) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-20560279]1-273 [EBI-20560279]Q08850,1 direct interaction direct interaction Fig. 2 vamp2-stxbp3-1 1 3 unspecified role unspecified role prey prey purified purified His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli-m15 Escherichia coli M15 5 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region SNARE sufficient to bind sufficient binding region sufficient to bind range range range range direct interaction direct interaction Fig. 2 stxbp3-stx4-1 2 3 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli-m15 Escherichia coli M15 4 unspecified role unspecified role prey prey purified purified cytosolic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-20560337]The shifted ranges (1-273) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-20560337]1-273 [EBI-20560337]Q08850,1 direct interaction direct interaction Fig. 3A The addition of increasing amounts of VAMP2 had no effect on pre-formed complexes of Sx4:Munc18c (Fig 3A). stxbp3-stx4-2 2 3 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli-m15 Escherichia coli M15 4 predetermined predetermined participant predetermined weight by comassie molecular weight estimation by coomasie staining weight by comassie competitor competitor competitor neutral component neutral component purified purified cytosolic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-20560399]The shifted ranges (1-273) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-20560399]1-273 [EBI-20560399]Q08850,1 5 unspecified role unspecified role prey prey purified purified cytosolic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 3B addition of Sx4 (but not the non-cognate syntaxin, Sx16) readily displaced VAMP2 from VAMP2:Munc18c complexes (Fig 3B).