IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. A feedback regulatory loop between methyltransferase PRMT1 and orphan receptor TR3. Nucleic acids research 2009 imex curation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. I have inferred TR3 protein to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C I couldn't retrieve the seq of the NBRE probe, so not added. I couldn't retrieve(sent email to author on 31/05/2018) HA-Src-2, His-PRMT1, Ha-PRMT1 and Flag-STAT3 so interaction with these constructs are missing. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Accepted 2018-JUN-21 AT 11:36 BST AT 11:36 BST by MGT Nucleic acids research 2009 imex curation I've modified part detection method, 'expressed in' and ranges according to you suggestions... I couldn't find info on construct used for methylation assay, so not annotated.; corrected nr4a1_human Nuclear receptor subfamily 4 group A member 1 Orphan nuclear receptor HMR Early response protein NAK1 Orphan nuclear receptor TR3 ST-59 GFRP1 HMR NAK1 NR4A1 Nuclear hormone receptor NUR/77 Testicular receptor 3 protein protein human Homo sapiens Human MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF DIP protein P22736 original sequence version: 156 41DAAEA7C25FDA22 anm1_human Protein arginine N-methyltransferase 1 PRMT1 Interferon receptor 1-bound protein 4 Histone-arginine N-methyltransferase PRMT1 HMT2 HRMT1L2 IR1B4 protein protein human Homo sapiens Human MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR DIP protein Q99873 original sequence version: 87 DIP protein Q99873 original sequence version: 125 544349801B0E1396 nurre_probe consensus TR3 response element (NurRE) probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GATCCGTGACCTTTATTCTCAAAGGTCA ccnd2_human_gene G1/S-specific cyclin D2 gene gene gene human Homo sapiens Human ncoa2_human Nuclear receptor coactivator 2 NCOA2 TIF2 Transcriptional intermediary factor 2 BHLHE75 Class E basic helix-loop-helix protein 75 SRC2 protein protein human Homo sapiens Human MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLVRRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLSSNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQAQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC DIP protein Q15596 original sequence version: 91 DIP protein Q15596 original sequence version: 116 DIP protein Q15596 original sequence version: 155 DIP protein Q15596 original sequence version: 136 DIP protein Q15596 original sequence version: 125 0A61AA5D1878304B khdr1_mouse KH domain-containing, RNA-binding, signal transduction-associated protein 1 p21 Ras GTPase-activating protein-associated p62 GAP-associated tyrosine phosphoprotein p62 Src-associated in mitosis 68 kDa protein p68 Khdrbs1 protein protein mouse Mus musculus Mouse MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGGPRGGARASPATQPPPLLPPSTPGPDATVVGSAPTPLLPPSATAAVKMEPENKYLPELMAEKDSLDPSFTHAMQLLSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVSVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGSITRGATVTRGVPPPPTVRGAPTPRARTAGIQRIPLPPTPAPETYEDYGYDDTYAEQSYEGYEGYYSQSQGESEYYDYGHGELQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY D33DE960BEA9E5AA prmt1-1 8 10 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig.1 G prmt1-nr4a1-1 1 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q99873:p.Ser97_Thr99delinsAlaAlaAla S69A, G70A, and T71A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain SGT AAA Tue Jun 30 18:23:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser97_Thr99delinsAlaAlaAla' 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.1 F, Fig.2A Co-IP assays revealed that deletion of the C-terminus from TR3 (TR3/D2) abolished its binding to PRMT1 (Figure 2A, bottom), indicating that the C-terminus is a crucial region for TR3-PRMT1 interaction. Further mapping analysis demonstrated that LBD (aa 440–598) is the predominant PRMT1-binding region, although the DBD also showed a very weak interaction with PRMT1 Co-IP assays revealed that deletion of the C-terminus from TR3 (TR3/D2) abolished its binding to PRMT1 (Figure 2A, bottom), indicating that the C-terminus is a crucial region for TR3-PRMT1 interaction. Further mapping analysis demonstrated that LBD (aa 440–598) is the predominant PRMT1-binding region, although the DBD also showed a very weak interaction with PRMT1 tr3-1 2 9 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig.2B, 2C nurre_probe-nr4a1-1 7 9 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig.2B, 2C nurre_probe-nr4a1-2 7 10 stimulator stimulator neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q99873:p.Ser97_Thr99delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain SGT AAA Tue Jun 30 16:49:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser97_Thr99delinsAlaAlaAla' ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig.2B, 2C nurre_probe-nr4a1-3 7 11 competitor competitor competitor neutral component neutral component purified purified in vitro In vitro 9 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig.2B, 2C nurre_probe-nr4a1-4 2 9 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 3C ccnd2-1 6 9 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3B nr4a1-ccnd2_human_gene-1 6 10 stimulator stimulator neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q99873:p.Ser97_Thr99delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain SGT AAA Tue Jun 30 17:08:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser97_Thr99delinsAlaAlaAla' myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3B prmt1-nr4a1-3 8 13 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig.3E prmt1-nr4a1-4 1 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3F Co-IP assays revealed that deletion of the C-terminus from TR3 (TR3/D2) abolished its binding to PRMT1 (Figure 2A, bottom), indicating that the C-terminus is a crucial region for TR3-PRMT1 interaction. Further mapping analysis demonstrated that LBD (aa 440–598) is the predominant PRMT1-binding region, although the DBD also showed a very weak interaction with PRMT1 Co-IP assays revealed that deletion of the C-terminus from TR3 (TR3/D2) abolished its binding to PRMT1 (Figure 2A, bottom), indicating that the C-terminus is a crucial region for TR3-PRMT1 interaction. Further mapping analysis demonstrated that LBD (aa 440–598) is the predominant PRMT1-binding region, although the DBD also showed a very weak interaction with PRMT1 prmt1-tr3-1 5 9 unspecified role unspecified role prey prey partially purified partially purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4E prmt1-nr4a1-5 5 10 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey partially purified partially purified myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supplementary Fig. I prmt1-nr4a1-6 4 10 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig.6A prmt1-khdrbs1-1 3 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 anti-tag immunocytochemistry anti-tag immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5H