IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease. A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease. Immunity 2007 imex curation Henderson KN., Tye-Din JA., Reid HH., Chen Z., Borg NA., Beissbarth T., Tatham A., Mannering SI., Purcell AW., Dudek NL., van Heel DA., McCluskey J., Rossjohn J., Anderson RP. banderson@wehi.edu.au,jamie.rossjohn@med.monash.edu.au 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Henderson KN., Tye-Din JA., Reid HH., Chen Z., Borg NA., Beissbarth T., Tatham A., Mannering SI., Purcell AW., Dudek NL., van Heel DA., McCluskey J., Rossjohn J., Anderson RP. not a sandwich Elisa as only one antibody is used. The HLA-DQA1 and DQB1 sequences added here have been taken from those given in PDBe database;the DQA1 sequence corresponds to HLA-DQA1 allele DQA1*03:01:01. The DQB1 sequence corresponds to allele DQB1*03:02. (both alleles found in the 9031 lymphblastoid cell line.) banderson@wehi.edu.au,jamie.rossjohn@med.monash.edu.au Accepted 2018-MAY-23 AT 15:39 BST AT 15:39 BST by PPORRAS Immunity 2007 Only protein-protein interactions imex curation imex curation I have added missing annotations and capitalised the mutation that was not.; added letters to figure and removed cloned "figure 2" interaction. A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease. A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease. Immunity 2007 imex curation Henderson KN., Tye-Din JA., Reid HH., Chen Z., Borg NA., Beissbarth T., Tatham A., Mannering SI., Purcell AW., Dudek NL., van Heel DA., McCluskey J., Rossjohn J., Anderson RP. banderson@wehi.edu.au,jamie.rossjohn@med.monash.edu.au 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Henderson KN., Tye-Din JA., Reid HH., Chen Z., Borg NA., Beissbarth T., Tatham A., Mannering SI., Purcell AW., Dudek NL., van Heel DA., McCluskey J., Rossjohn J., Anderson RP. The HLA-DQA1 and DQB1 sequences added here have been taken from those given in PDBe database;the DQA1 sequence corresponds to HLA-DQA1 allele DQA1*03:01:01. The DQB1 sequence corresponds to allele DQB1*03:02. (both alleles found in the 9031 lymphblastoid cell line.) banderson@wehi.edu.au,jamie.rossjohn@med.monash.edu.au Accepted 2018-MAY-23 AT 15:39 BST AT 15:39 BST by PPORRAS Immunity 2007 Only protein-protein interactions imex curation imex curation I have added missing annotations and capitalised the mutation that was not.; added letters to figure and removed cloned "figure 2" interaction. dqa1_human HLA class II histocompatibility antigen, DQ alpha 1 chain DC-alpha HLA-DCA DC-1 alpha chain MHC class II DQA1 HLA-DQA1 protein protein human Homo sapiens Human MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL 84E12B5A80E2A028 hg2a_human HLA class II histocompatibility antigen gamma chain DHLAG HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain CD74 protein protein human Homo sapiens Human MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM 27A13F252D5FB91D dqb1_human HLA class II histocompatibility antigen, DQ beta 1 chain HLA-DQB1 HLA-DQB MHC class II antigen DQB1 protein protein human Homo sapiens Human MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH 79B1E571A628CF96 gda9_wheat Alpha/beta-gliadin MM1 Prolamin protein protein wheat Triticum aestivum (Wheat) MKTFLILALLAIVATTARIAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPFRPQQPYPQSQPQYSQPQQPISQQQQQQQQQQQQKQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAYGSSQVLQQSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQPLSQVSFQQPQQQYPSGQGSFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN 06C1858BD96F1E08 67889oyuiuylo-1 2 5 unspecified role unspecified role neutral component neutral component purified purified p.[Ala45Gly;Tyr58Leu;Glu77Gly;Asp89Ala;His199Arg;Thr217Ile] variant variant certain certain sequence position certain certain certain sequence position certain Y L certain certain sequence position certain certain certain sequence position certain E G certain certain sequence position certain certain certain sequence position certain A G certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain T I ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3 unspecified role unspecified role neutral component neutral component purified purified p.val73_Asp80delinsLeuPheArgArgPheArgArgPhe variant variant certain certain sequence position certain certain certain sequence position certain VLRQFRFD LFRRFRRFD ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain p.[Thr49Ser;Gln57Glu;Gly63Glu;Cys70Gln;Ile129Thr;Leu178Phe;Glu183Asp;Ser185Ile;Lys197Glu] variant variant certain certain sequence position certain certain certain sequence position certain T S certain certain sequence position certain certain certain sequence position certain Q E certain certain sequence position certain certain certain sequence position certain G E certain certain sequence position certain certain certain sequence position certain C Q certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L F certain certain sequence position certain certain certain sequence position certain E D certain certain sequence position certain certain certain sequence position certain S I certain certain sequence position certain certain certain sequence position certain K E p.Ser97_Leu98delinsIleVal variant variant certain certain sequence position certain certain certain sequence position certain SL IV spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role neutral component neutral component purified purified P18573:p.[Gln249Glu;Gln257Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain Q E certain certain sequence position certain certain certain sequence position certain Q E Tue Jun 30 18:44:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln249Glu;Gln257Glu]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Table S4 2.1 A RWork =0.217 RFree =0.248 cd74-hla_dqa1-1 1 5 unspecified role unspecified role bait bait cell lysate cell lysate p.[Ala45Gly;Tyr58Leu;Glu77Gly;Asp89Ala;His199Arg;Thr217Ile] variant variant certain certain sequence position certain certain certain sequence position certain Y L certain certain sequence position certain certain certain sequence position certain E G certain certain sequence position certain certain certain sequence position certain A G certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain T I region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. 3 unspecified role unspecified role bait bait cell lysate cell lysate p.val73_Asp80delinsLeuPheArgArgPheArgArgPhe variant variant certain certain sequence position certain certain certain sequence position certain VLRQFRFD LFRRFRRFD region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p.[Thr49Ser;Gln57Glu;Gly63Glu;Cys70Gln;Ile129Thr;Leu178Phe;Glu183Asp;Ser185Ile;Lys197Glu] variant variant certain certain sequence position certain certain certain sequence position certain T S certain certain sequence position certain certain certain sequence position certain Q E certain certain sequence position certain certain certain sequence position certain G E certain certain sequence position certain certain certain sequence position certain C Q certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L F certain certain sequence position certain certain certain sequence position certain E D certain certain sequence position certain certain certain sequence position certain S I certain certain sequence position certain certain certain sequence position certain K E p.Ser97_Leu98delinsIleVal variant variant certain certain sequence position certain certain certain sequence position certain SL IV human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. 4 unspecified role unspecified role prey prey purified purified clip_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 25 22 physical association physical association Figure S1B hla_dqa1-cd74-1 1 6 competitor competitor competitor unspecified role unspecified role P18573:p.[Gln249Glu;Gln257Glu] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain Q E certain certain sequence position certain certain certain sequence position certain Q E Wed Jun 13 17:51:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[gln249glu;gln257glu]' Tue Jun 30 16:20:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln249Glu;Gln257Glu]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait cell lysate cell lysate p.[Ala45Gly;Tyr58Leu;Glu77Gly;Asp89Ala;His199Arg;Thr217Ile] variant variant certain certain sequence position certain certain certain sequence position certain Y L certain certain sequence position certain certain certain sequence position certain E G certain certain sequence position certain certain certain sequence position certain A G certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain T I region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. 3 unspecified role unspecified role bait bait cell lysate cell lysate p.Val73_Asp80delinsLeuPheArgArgPheArgArgPhe variant variant certain certain sequence position certain certain certain sequence position certain VLRQFRFD LFRRFRRFD region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p.[Thr49Ser;Gln57Glu;Gly63Glu;Cys70Gln;Ile129Thr;Leu178Phe;Glu183Asp;Ser185Ile;Lys197Glu] variant variant certain certain sequence position certain certain certain sequence position certain T S certain certain sequence position certain certain certain sequence position certain Q E certain certain sequence position certain certain certain sequence position certain G E certain certain sequence position certain certain certain sequence position certain C Q certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L F certain certain sequence position certain certain certain sequence position certain E D certain certain sequence position certain certain certain sequence position certain S I certain certain sequence position certain certain certain sequence position certain K E p.Ser97_Leu98delinsIleVal variant variant certain certain sequence position certain certain certain sequence position certain SL IV human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. 4 unspecified role unspecified role prey prey purified purified clip_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 40 37 physical association physical association Figure S1B A peptide TPO 632–645(Y) of unknown origin and sequence also inhibited CLIP binding.