DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 1998 imex curation Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265140X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 1998 imex curation Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265136X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 1998 imex curation Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265137X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 1998 imex curation Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265138X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 1998 imex curation Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265139X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 1998 imex curation Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265141X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF DIP protein Q01094 original sequence version: 173 DIP protein Q01094 original sequence version: 168 DIP protein Q01094 original sequence version: 149 DIP protein Q01094 original sequence version: 130 DIP protein Q01094 original sequence version: 125 DIP protein Q01094 original sequence version: 153 DIP protein Q01094 original sequence version: 180 003B3F654F0C60DF hdac1-rb1-2 2 8 unspecified role unspecified role bait bait human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association e2f1-hdac1-2 6 9 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey 414-418 Deletion 414-417 Deletion required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S Label 35S Label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association rb1-hdac1-6 3 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association rb1-hdac1-8 5 8 unspecified role unspecified role prey prey 35S Label 35S Label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 414-418 Deletion 414-417 Deletion required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rb1-hdac1-9 4 8 unspecified role unspecified role prey prey 35S Label 35S Label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait P06400:p.Cys706Phe C706F Mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C F This feature has been corrected as a result of our quality control procedures. The original label was 'C706F Mutation'. Wed May 02 19:53:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys706phe' Tue Jun 30 20:03:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys706Phe' GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction hdac1-rb1-3 1 8 unspecified role unspecified role bait bait p.Ile414_Glu417del 414-417 Deletion mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain IACE . HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association