DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of mouse CD1: An MHC-like fold with a large hydrophobic binding groove. Crystal structure of mouse CD1: An MHC-like fold with a large hydrophobic binding groove. Science (New York, N.Y.) 1997 imex curation Zeng Z., Castaño AR., Segelke BW., Stura EA., Peterson PA., Wilson IA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zeng Z., Castaño AR., Segelke BW., Stura EA., Peterson PA., Wilson IA. DIP original experiment: DIP-268343X Science (New York, N.Y.) 1997 IMEx Crystal structure of mouse CD1: An MHC-like fold with a large hydrophobic binding groove. b2mg_mouse Beta-2-microglobulin B2m protein protein mouse Mus musculus Mouse MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM DIP protein P01887 original sequence version: 171 94F649EBCF1D7A4E cd1d1_mouse Antigen-presenting glycoprotein CD1d1 Cd1d1 Cd1.1 protein protein mouse Mus musculus Mouse MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSADGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR DIP protein P11609 original sequence version: 159 E4A666E1942E0114 b2m-cd1d1-1 1 2 unspecified role unspecified role unspecified role unspecified role 21-119 binding region 21-119 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 3 unspecified role unspecified role unspecified role unspecified role 22-336 binding region 22-336 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction