DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure of the Escherichia coli EF-Tu.EF-Ts complex at 2.5 A resolution. The structure of the Escherichia coli EF-Tu.EF-Ts complex at 2.5 A resolution. Nature 1996 imex curation Kawashima T., Berthet-Colominas C., Wulff M., Cusack S., Leberman R. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kawashima T., Berthet-Colominas C., Wulff M., Cusack S., Leberman R. DIP original experiment: DIP-267032X Nature 1996 IMEx The structure of the Escherichia coli EF-Tu.EF-Ts complex at 2.5 A resolution. eftu2_ecoli Elongation factor Tu 2 tufB P-43 JW3943 b3980 Bacteriophage Q beta RNA-directed RNA polymerase subunit III protein protein ecoli Escherichia coli (strain K12) MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLS DIP protein P0CE48 original sequence version: 53 DIP protein P0CE48 original sequence version: null 6EDA60255F43358F efts_ecoli Elongation factor Ts tsf Bacteriophage Q beta RNA-directed RNA polymerase subunit IV JW0165 b0170 protein protein ecoli Escherichia coli (strain K12) MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS DIP protein P0A6P1 original sequence version: 111 DIP protein P0A6P1 original sequence version: 72 0B9D21E928A5051C tsf-tufb-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role 10-394 binding region 10-394 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction