DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. Nature 1995 imex curation Swaffield JC., Melcher K., Johnston SA. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Swaffield JC., Melcher K., Johnston SA. DIP original experiment: DIP-267013X Nature 1995 IMEx A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. Nature 1995 imex curation Swaffield JC., Melcher K., Johnston SA. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Swaffield JC., Melcher K., Johnston SA. DIP original experiment: DIP-267014X Nature 1995 IMEx A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. Nature 1995 imex curation Swaffield JC., Melcher K., Johnston SA. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Swaffield JC., Melcher K., Johnston SA. DIP original experiment: DIP-267016X Nature 1995 IMEx A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. Nature 1995 imex curation Swaffield JC., Melcher K., Johnston SA. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Swaffield JC., Melcher K., Johnston SA. DIP original experiment: DIP-267011X Nature 1995 IMEx A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. Nature 1995 imex curation Swaffield JC., Melcher K., Johnston SA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Swaffield JC., Melcher K., Johnston SA. DIP original experiment: DIP-267015X Nature 1995 IMEx A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. Nature 1995 imex curation Swaffield JC., Melcher K., Johnston SA. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Swaffield JC., Melcher K., Johnston SA. DIP original experiment: DIP-267012X Nature 1995 IMEx A highly conserved ATPase protein as a mediator between acidic activation domains and the TATA-binding protein. gal4_yeast Regulatory protein GAL4 GAL4 YPL248C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNKDAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVSIDSAAHHDNSTIPLDFMPRDALHGFDWSEEDDMSDGLPFLKTDPNNNGFFGDGSLLCILRSIGFKPENYTNSNVNRLPTMITDRYTLASRSTTSRLLQSYLNNFHPYCPIVHSPTLMMLYNNQIEIASKDQWQILFNCILAIGAWCIEGESTDIDVFYYQNAKSHLTSKVFESGSIILVTALHLLSRYTQWRQKTNTSYNFHSFSIRMAISLGLNRDLPSSFSDSSILEQRRRIWWSVYSWEIQLSLLYGRSIQLSQNTISFPSSVDDVQRTTTGPTIYHGIIETARLLQVFTKIYELDKTVTAEKSPICAKKCLMICNEIEEVSRQAPKFLQMDISTTALTNLLKEHPWLSFTRFELKWKQLSLIIYVLRDFFTNFTQKKSQLEQDQNDHQSYEVKRCSIMLSDAAQRTVMSVSSYMDNHNVTPYFAWNCSYYLFNAVLVPIKTLLSNSKSNAENNETAQLLQQINTVLMLLKKLATFKIQTCEKYIQVLEEVCAPFLLSQCAIPLPHISYNNSNGSAIKNIVGSATIAQYPTLPEENVNNISVKYVSPGSVGPSPVPLKSGASFSDLVKLLSNRPPSRNSPVTIPRSTPSHRSVTPFLGQQQQLQSLVPLTPSALFGGANFNQSGNIADSSLSFTFTNSSNGPNLITTQTNSQALSQPIASSNVHDNFMNNEITASKIDDGNNSKPLSPGWTDQTAYNAFGITTGMFNTTTMDDVYNYLFDDEDTPPNPKKE 29D7FF68B0B05880 29D7FF68B0B05880 gal80_yeast Galactose/lactose metabolism regulatory protein GAL80 GAL80 YM9958.12 YM9827.01 YML051W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDYNKRSSVSTVPNAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRANDFPLANGQQAPLDPGYDAGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL 1492473684F3894C 1492473684F3894C prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F 9C59E92A0794F60F vp16_hhv11 Tegument protein VP16 Vmw65 ICP25 Alpha-TIF Alpha trans-inducing protein UL48 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MDLLVDELFADMNADGASPPPPRPAGGPKNTPAAPPLYATGRLSQAQLMPSPPMPVPPAALFNRLLDDLGFSAGPALCTMLDTWNEDLFSALPTNADLYRECKFLSTLPSDVVEWGDAYVPERTQIDIRAHGDVAFPTLPATRDGLGLYYEALSRFFHAELRAREESYRTVLANFCSALYRYLRASVRQLHRQAHMRGRDRDLGEMLRATIADRYYRETARLARVLFLHLYLFLTREILWAAYAEQMMRPDLFDCLCCDLESWRQLAGLFQPFMFVNGALTVRGVPIEARRLRELNHIREHLNLPLVRSAATEEPGAPLTTPPTLHGNQARASGYFMVLIRAKLDSYSSFTTSPSEAVMREHAYSRARTKNNYGSTIEGLLDLPDDDAPEEAGLAAPRLSFLPAGHTRRLSTAPPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG DIP protein P06492 original sequence version: 97 DIP protein P06492 original sequence version: 93 DIP protein P06492 original sequence version: 107 mint Responsible for transcriptional activation of immediate early promoters (alpha genes). Activation requires the formation of a heteromeric complex with the host cell factor. These two proteins then assemble with the octamer motif-binding protein Oct-1 on the cis-acting target sequence: 5'-TAATGARAT-3' 8DDDEDEDB2A699D3 tbp_yeast TATA-box-binding protein YER148W SPT15 BTF1 TBP1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription factor D Transcription initiation factor TFIID TBP subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 50365FFF1D3718CE 50365FFF1D3718CE vp16_hhv11-gal80p-1 1 10 unspecified role unspecified role bait bait 411-490 binding region 411-490 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction gal4p-gal80p-1 4 8 unspecified role unspecified role prey prey in vitro In vitro 7 unspecified role unspecified role bait bait 841-875 binding region 841-875 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sug1p-tata-1 5 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tata-sug1p-1 3 11 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction vp16_hhv11-sug1p-1 2 10 unspecified role unspecified role bait bait 411-490 binding region 411-490 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction gal4p-sug1p-1 6 9 unspecified role unspecified role prey prey in vitro In vitro 7 unspecified role unspecified role bait bait 841-875 binding region 841-875 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction