DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. Nature 1995 imex curation Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. DIP original experiment: DIP-267000X Nature 1995 IMEx Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. Nature 1995 imex curation Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. DIP original experiment: DIP-266999X Nature 1995 IMEx Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C 30BD644BA9836B2C ste20_yeast Serine/threonine-protein kinase STE20 STE20 YHL007C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNDPSAVSELPDKDSLDNGISNDNERAMGGNGDGGDGLRLPRTTGTLNVNALQKGTNAAHEAGGYKSMDPAKNAETTNDDDNNVVSLDDPIQFTRVSSSSVISGMSSSMSPHSNIDETKSLEAVTPNINTSNITPDHSADNTFSTINASESDHQFNDTLLSKLSLTDSTETIENNATVKHQQPVASSTVNSNKSSTDIRRATPVSTPVISKPSMTTTPRQINSASHSLSNPKHKQHKPKVKPSKPEAKSKPVSVKKSFPSKNPLKNSSPPKKQTEKSYYSSSSKKRKSGSNSGTLRMKDVFTSFVQNIKRNSQDDKRASSSSNNSSSSSITTALRISTPYNAKHIHHVGVDSKTGEYTGLPEEWEKLLTSSGISKREQQQNMQAVMDIVKFYQDVTETNGEDKMFKTFNTTTGLPGSPQVSTPPANSFNKFPPSTSDSHNYGSRTGTPMSNHVMSPTLNTDSSSANGKFIPSRPAPKPPSSASASAPIIKSPVMNSAANVSPLKQTHAPTTPNRTSPNRSSISRNATLKKEEQPLPPIPPTKSKTSPIISTAHTPQQVAQSPKAPAQETVTTPTSKPAQARSLSKELNEKKREERERRKKQLYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLARLKKVAENMDADEDNDDDNDNEHINKTNNCDDNNDSKETVNLDVTEDDKQK 69C1C12F5B87733C 69C1C12F5B87733C ste20p-cdc42p-1 2 3 unspecified role unspecified role prey prey P19073:p.Cys188Ser C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C188S mutation'. Wed May 02 14:27:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 17:07:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' P19073:p.[Gly12Val;Cys188Ser] G12V/C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain G V This feature has been corrected as a result of our quality control procedures. The original label was 'G12V/C188S mutation'. Wed May 02 19:48:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val,cys188ser' Tue Jun 30 20:20:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly12Val;Cys188Ser]' P19073:p.[Gln61Leu;Cys188Ser] Q61L/C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain Q L certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'Q61L/C188S mutation'. Wed May 02 18:40:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu,cys188ser' Tue Jun 30 18:42:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln61Leu;Cys188Ser]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc42p-ste20p-1 1 3 unspecified role unspecified role bait bait P19073:p.Cys188Ser C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C188S mutation'. Wed May 02 15:52:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 18:41:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association