IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interleukin-6 Induces DEC1, Promotes DEC1 Interaction with RXRα and Suppresses the Expression of PXR, CAR and Their Target Genes. Interleukin-6 Induces DEC1, Promotes DEC1 Interaction with RXRα and Suppresses the Expression of PXR, CAR and Their Target Genes. Frontiers in pharmacology 2016 imex curation Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn Accepted 2018-JAN-04 AT 12:31 GMT AT 12:31 GMT by LIVIAP Frontiers in pharmacology 2016 imex curation Interleukin-6 Induces DEC1, Promotes DEC1 Interaction with RXRα and Suppresses the Expression of PXR, CAR and Their Target Genes. Interleukin-6 Induces DEC1, Promotes DEC1 Interaction with RXRα and Suppresses the Expression of PXR, CAR and Their Target Genes. Frontiers in pharmacology 2016 imex curation Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep2 Homo sapiens hep2 hep2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn Accepted 2018-JAN-04 AT 12:31 GMT AT 12:31 GMT by LIVIAP Frontiers in pharmacology 2016 imex curation Interleukin-6 Induces DEC1, Promotes DEC1 Interaction with RXRα and Suppresses the Expression of PXR, CAR and Their Target Genes. Interleukin-6 Induces DEC1, Promotes DEC1 Interaction with RXRα and Suppresses the Expression of PXR, CAR and Their Target Genes. Frontiers in pharmacology 2016 imex curation Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. Cross-linker is Formaldehyde DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn Accepted 2018-JAN-04 AT 12:31 GMT AT 12:31 GMT by LIVIAP Frontiers in pharmacology 2016 imex curation bhe40_human Class E basic helix-loop-helix protein 40 BHLHE40 Differentially expressed in chondrocytes protein 1 Enhancer-of-split and hairy-related protein 2 Stimulated by retinoic acid gene 13 protein BHLHB2 DEC1 SHARP2 STRA13 Class B basic helix-loop-helix protein 2 protein protein human Homo sapiens Human MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD DIP protein O14503 original sequence version: 112 2D73A3D4980793E5 rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT DIP protein P19793 original sequence version: 177 DIP protein P19793 original sequence version: 107 DIP protein P19793 original sequence version: 153 DIP protein P19793 original sequence version: 131 DIP protein P19793 original sequence version: 136 DIP protein P19793 original sequence version: 169 DIP protein P19793 original sequence version: 161 DIP protein P19793 original sequence version: 139 7F952B580AD84C42 23423wrer-1 3 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association Figure 8 A/B bhlhe40-rxra-1 2 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 8C IL6 bhlhe40-rxra-2 2 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 8D 231eqdaf-1 1 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 8E