IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding. A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding. Science signaling 2017 imex curation Zuo J., Willcox CR., Mohammed F., Davey M., Hunter S., Khan K., Antoun A., Katakia P., Croudace J., Inman C., Parry H., Briggs D., Malladi R., Willcox BE., Moss P. identifiers given in Supplement! Q5VY80 entry corresponds to sequence given for allele ULBP060602. p.moss@bham.ac.uk,b.willcox@bham.ac.uk 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zuo J., Willcox CR., Mohammed F., Davey M., Hunter S., Khan K., Antoun A., Katakia P., Croudace J., Inman C., Parry H., Briggs D., Malladi R., Willcox BE., Moss P. identifiers given in Supplement! Q5VY80 entry corresponds to sequence given for allele ULBP060602. p.moss@bham.ac.uk,b.willcox@bham.ac.uk Accepted 2017-SEP-13 AT 09:39 BST AT 09:39 BST by ORCHARD Science signaling 2017 imex curation A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding. A disease-linked ULBP6 polymorphism inhibits NKG2D-mediated target cell killing by enhancing the stability of NKG2D ligand binding. Science signaling 2017 imex curation Zuo J., Willcox CR., Mohammed F., Davey M., Hunter S., Khan K., Antoun A., Katakia P., Croudace J., Inman C., Parry H., Briggs D., Malladi R., Willcox BE., Moss P. identifiers given in Supplement! Q5VY80 entry corresponds to sequence given for allele ULBP060602. p.moss@bham.ac.uk,b.willcox@bham.ac.uk 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zuo J., Willcox CR., Mohammed F., Davey M., Hunter S., Khan K., Antoun A., Katakia P., Croudace J., Inman C., Parry H., Briggs D., Malladi R., Willcox BE., Moss P. identifiers given in Supplement! Q5VY80 entry corresponds to sequence given for allele ULBP060602. p.moss@bham.ac.uk,b.willcox@bham.ac.uk Accepted 2017-SEP-13 AT 09:39 BST AT 09:39 BST by ORCHARD Science signaling 2017 imex curation ulbp3_human UL16-binding protein 3 NKG2D ligand 3 ULBP3 N2DL3 RAET1N ALCAN-gamma Retinoic acid early transcript 1N protein protein human Homo sapiens Human MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI BAF07895640B9901 nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV DIP protein P26718 original sequence version: 106 C22F6BD533D7800E rae1e_human Retinoic acid early transcript 1E NKG2D ligand 4 Lymphocyte effector toxicity activation ligand RAE-1-like transcript 4 UL16-binding protein 4 RAET1E LETAL N2DL4 ULBP4 UNQ1867/PRO4303 protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS 3309279B51B603C8 ulbp6_human UL16-binding protein 6 Retinoic acid early transcript 1L protein ULBP6 RAET1L protein protein human Homo sapiens Human MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI 5FBBEA2289E32690 ulbp1_human UL16-binding protein 1 ALCAN-beta Retinoic acid early transcript 1I NKG2D ligand 1 ULBP1 N2DL1 RAET1I protein protein human Homo sapiens Human MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR 6094B17CE383DC6D ulbp2_human UL16-binding protein 2 ULBP2 NKG2D ligand 2 N2DL2 RAET1H ALCAN-alpha Retinoic acid early transcript 1H UNQ463/PRO791 protein protein human Homo sapiens Human MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI 804D1A0D4A9C5CF8 raet1l-klrk1-1 2 6 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain leu106arg,thr147ile variant variant certain certain sequence position certain certain certain sequence position certain T I certain certain sequence position certain certain certain sequence position certain L N Q5VY80:p.Thr147Ile mutation mutation certain certain sequence position certain certain certain sequence position certain T I Wed May 02 17:59:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr147ile' Tue Jun 30 20:17:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr147Ile' Q5VY80:p.Leu106Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L R Wed May 02 18:47:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu106arg' Tue Jun 30 16:14:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu106Arg' drome Drosophila melanogaster (Fruit fly) Fruit fly 4 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A, 4G, table S1 raet1l-klrk1-2 2 6 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain leu106arg,thr147ile variant variant certain certain sequence position certain certain certain sequence position certain T I certain certain sequence position certain certain certain sequence position certain L N drome Drosophila melanogaster (Fruit fly) Fruit fly 4 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B raet1l-klrk1-3 2 7 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range drome Drosophila melanogaster (Fruit fly) Fruit fly 4 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A-2, Supp fig 2A Kd values from Supp. Table 1 and Supp. figure 2A have both been entered. klrk1-raet1l-1 2 7 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range drome Drosophila melanogaster (Fruit fly) Fruit fly 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B-2 klrk1-ulbp1-1 2 8 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp fig 2B klrk1-ulbp2-1 2 3 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 4 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp fig 2C, Table S1 klrk1-ulbp2-2 2 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction Supp fig 2D raet1l-klrk1-4 1 6 unspecified role unspecified role neutral component neutral component ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q5VY80:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Nov 02 15:10:19 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34 ser' Wed May 02 18:23:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 17:27:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Table 2 2.35A RFree =0.286 RWork=0.238 klrk1-ulbp2-3 2 8 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S1 klrk1-raet1e-1 2 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction Table S1