IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Science immunology 2017 imex curation Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-b12 mouse B12 -immortalised subclone of BALB/c MEFS Mouse b12 B12 -immortalised subclone of BALB/c MEFS anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. Reporter cells expressing a chimeric cell surface receptor consisting of the extracellular domains of either human or mouse NKp46 fused to mouse CD3-zeta were cocultured with B12 cells in the presence of the 27A1.7 mAb ( -target JAM1). This antibody blocked reporter cell activation suggesting that it might recognize a ligand for NKp46. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr narni@ciml.univ - mrs.fr,vivier @ciml.univ - mrs.fr Accepted 2017-AUG-03 AT 09:03 BST AT 09:03 BST by ORCHARD Science immunology 2017 imex curation Have altered; I probably forgot to change the Fc tag after cloning.; altered; I dont think in Figs 4 B/C there are any tags on NKp46 Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Science immunology 2017 imex curation Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. Supp fig 5: I have entered CFP as "purified" so presumably they have checked that dimers/tetramers really are present?- but evidence for this is not shown anywhere. (? remove these 2 interactions?) vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr narni@ciml.univ - mrs.fr,vivier @ciml.univ - mrs.fr Accepted 2017-AUG-03 AT 09:03 BST AT 09:03 BST by ORCHARD Science immunology 2017 imex curation Have altered; I probably forgot to change the Fc tag after cloning.; altered; I dont think in Figs 4 B/C there are any tags on NKp46 Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Science immunology 2017 imex curation Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. "KHYG1 Cl3C4 NKp46high cells" (Innate Pharma) were used - it has been assumed these are expressing Human NKp46, but no further details can be found for these cells. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr narni@ciml.univ - mrs.fr,vivier @ciml.univ - mrs.fr Accepted 2017-AUG-03 AT 09:03 BST AT 09:03 BST by ORCHARD Science immunology 2017 imex curation Have altered; I probably forgot to change the Fc tag after cloning.; altered; I dont think in Figs 4 B/C there are any tags on NKp46 Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Science immunology 2017 imex curation Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. Mouse CFP-HIS is stated to have accession no. P11680; amino acid 24D-464L. However there is no "L" at position 464. DO11.10 mouse T cells expresssing a chimeric cell surface receptor consisting of the extracellular domains of either human or mouse NKp46 fused to mouse CD3. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr narni@ciml.univ - mrs.fr,vivier @ciml.univ - mrs.fr Accepted 2017-AUG-03 AT 09:03 BST AT 09:03 BST by ORCHARD Science immunology 2017 imex curation Have altered; I probably forgot to change the Fc tag after cloning.; altered; I dont think in Figs 4 B/C there are any tags on NKp46 Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Science immunology 2017 imex curation Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. Results from Fig 2F have not been entered as the origin of CFP-His is not stated. Mouse CFP-HIS is stated to have accession no. P11680; amino acid 24D-464L. However there is no "L" at position 464. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr narni@ciml.univ - mrs.fr,vivier @ciml.univ - mrs.fr Accepted 2017-AUG-03 AT 09:03 BST AT 09:03 BST by ORCHARD Science immunology 2017 imex curation Have altered; I probably forgot to change the Fc tag after cloning.; altered; I dont think in Figs 4 B/C there are any tags on NKp46 Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Complement factor P is a ligand for the natural killer cell-activating receptor NKp46. Science immunology 2017 imex curation Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E., Narni-Mancinelli E., Gauthier L., Baratin M., Guia S., Fenis A., Deghmane AE., Rossi B., Fourquet P., Escalière B., Kerdiles YM., Ugolini S., Taha MK., Vivier E. human IL-2–activated NKp46+ bulk NK cells gated on Cd56+ CD3- cells. vivier@ciml.univ-mrs.fr,narni@ciml.univ-mrs.fr narni@ciml.univ - mrs.fr,vivier @ciml.univ - mrs.fr Accepted 2017-AUG-03 AT 09:03 BST AT 09:03 BST by ORCHARD Science immunology 2017 imex curation Have altered; I probably forgot to change the Fc tag after cloning.; altered; I dont think in Figs 4 B/C there are any tags on NKp46 jam1_mouse Junctional adhesion molecule A F11r Jam1 Jcam Jcam1 Junctional adhesion molecule 1 protein protein mouse Mus musculus Mouse MGTEGKAGRKLLFLFTSMILGSLVQGKGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV DIP protein O88792 original sequence version: 123 mint Seems to plays a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Involved in platelet activation 3CE561E8FF3B97EC prop_mouse Properdin Cfp Pfc Complement factor P protein protein mouse Mus musculus Mouse MPAEMQAPQWLLLLLVILPATGSDPVLCFTQYEESSGRCKGLLGRDIRVEDCCLNAAYAFQEHDGGLCQACRSPQWSAWSLWGPCSVTCSEGSQLRHRRCVGRGGQCSENVAPGTLEWQLQACEDQPCCPEMGGWSEWGPWGPCSVTCSKGTQIRQRVCDNPAPKCGGHCPGEAQQSQACDTQKTCPTHGAWASWGPWSPCSGSCLGGAQEPKETRSRSCSAPAPSHQPPGKPCSGPAYEHKACSGLPPCPVAGGWGPWSPLSPCSVTCGLGQTLEQRTCDHPAPRHGGPFCAGDATRNQMCNKAVPCPVNGEWEAWGKWSDCSRLRMSINCEGTPGQQSRSRSCGGRKFNGKPCAGKLQDIRHCYNIHNCIMKGSWSQWSTWSLCTPPCSPNATRVRQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGTPRPLCEALQGQKLVVEEKRSCLHVPVCKDPEEKKP C787F5493042379A prop_human Properdin CFP PFC Complement factor P protein protein human Homo sapiens Human MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL 5EB42B63F0283917 p27918-pro_0000035863 Properdin CFP PFC Complement factor P protein protein human Homo sapiens Human DPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL 28 469 E1C2067C4C631C71 p11680-pro_0000043369 Properdin Complement factor P Cfp Pfc protein protein mouse Mus musculus Mouse SDPVLCFTQYEESSGRCKGLLGRDIRVEDCCLNAAYAFQEHDGGLCQACRSPQWSAWSLWGPCSVTCSEGSQLRHRRCVGRGGQCSENVAPGTLEWQLQACEDQPCCPEMGGWSEWGPWGPCSVTCSKGTQIRQRVCDNPAPKCGGHCPGEAQQSQACDTQKTCPTHGAWASWGPWSPCSGSCLGGAQEPKETRSRSCSAPAPSHQPPGKPCSGPAYEHKACSGLPPCPVAGGWGPWSPLSPCSVTCGLGQTLEQRTCDHPAPRHGGPFCAGDATRNQMCNKAVPCPVNGEWEAWGKWSDCSRLRMSINCEGTPGQQSRSRSCGGRKFNGKPCAGKLQDIRHCYNIHNCIMKGSWSQWSTWSLCTPPCSPNATRVRQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGTPRPLCEALQGQKLVVEEKRSCLHVPVCKDPEEKKP 23 464 47888B385E601BAF nctr1_human Natural cytotoxicity triggering receptor 1 NCR1 LY94 Lymphocyte antigen 94 homolog NK cell-activating receptor Natural killer cell p46-related protein protein protein human Homo sapiens Human MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL FBCBDE50D2F34CD3 nctr1_mouse Natural cytotoxicity triggering receptor 1 Ncr1 Ly94 Activating receptor 1 Lymphocyte antigen 94 Natural killer cell p46-related protein protein protein mouse Mus musculus Mouse MLPTLTALLCLGLCLSQRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQNLIRIGLACIILITLVWLLTEDWLSKRKDHEEANRLTNWECRRRWRMQHYFEEEQRNAISMMELKATPGAL ED24E48ABF22F029 f11r-cfp-1 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1D (Supp fig 3) Mass spectrometry revealed the presence of only two molecules in the material immunoabsorbed by 27A1 mAbs: the junctional adhesion molecule JAM1 and the complement factor P (CFP). ncr1-cfp-2 2 12 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 9 unspecified role unspecified role prey prey human-serum Homo sapiens serum Serum direct interaction direct interaction 2A ncr1-cfp-1 2 12 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 2B, Table S1 ncr1-cfp-3 2 13 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 2B, Table S1i ncr1-cfp-5 5 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 12 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 2C ncr1-cfp-4 5 13 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 11 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 2C-i ncr1-cfp-6 5 12 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 11 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 2Cii ncr1-cfp-7 5 13 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 2C-iii ncr1-cfp-8 6 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 12 unspecified role unspecified role bait bait human-nk_cells human-Natural Killer cells Human nk_cells Natural killer cells physical association physical association 4C Binding was detected by CFP to human IL-2–activated NKp46+ bulk NK cells but not to T cells present in the same cell preparations. we detected the binding of CFP to human IL-2–activated NKp46+ bulk NK cells but not to T cells present in the same cell preparations ncr1-cfp-11 4 13 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse_cd3-zeta tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-do11_10 Mus musculus T-cell hybridoma DO-11.10 do11_10 Mouse T-cell hybridoma DO-11.10 Mice carrying the MHC class II restricted rearranged T cell receptor transgene, Tg(DO11.10)10Dlo, react to ovalbumin (OVA) peptide antigen. 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 4A ncr1-cfp-10 4 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 12 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse_cd3-zeta tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-do11_10 Mus musculus T-cell hybridoma DO-11.10 do11_10 Mouse T-cell hybridoma DO-11.10 Mice carrying the MHC class II restricted rearranged T cell receptor transgene, Tg(DO11.10)10Dlo, react to ovalbumin (OVA) peptide antigen. physical association physical association 4A ncr1-cfp-9 2 13 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction Supp figure 5 ncr1-cfp-12 2 13 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction Supp figure 5-2 ncr1-cfp-13 3 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 12 unspecified role unspecified role bait bait human-khyg1 KHYG1-Natural killer cell lymphoblastic leukemia/lymphoma Human khyg1 KHYG1-Natural killer cell lymphoblastic leukemia/lymphoma http://web.expasy.org/cellosaurus/CVCL_2976 physical association physical association 4B