IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Analysis of the Interaction between Globular Head Modules of Human C1q and Its Candidate Receptor gC1qR. Analysis of the Interaction between Globular Head Modules of Human C1q and Its Candidate Receptor gC1qR. Frontiers in immunology 2015 imex curation Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U., Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U. BLAT of primers shows that C1qR=Q07021 (C1QBP) interaction(s) not in Intact, although not dark space. berhane.ghebrehiwet@stonybrookmedicine.edu,uday.kishore@brunel.ac.uk,ukishore@hotmail.com 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U., Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U. BLAT of primers shows that C1qR=Q07021 (C1QBP) interaction(s) not in Intact, although not dark space. berhane.ghebrehiwet@stonybrookmedicine.edu,uday.kishore@brunel.ac.uk,ukishore@hotmail.com Accepted 2017-SEP-13 AT 11:54 BST AT 11:54 BST by PPORRAS Frontiers in immunology 2015 Only protein-protein interactions imex curation imex curation Yes - I think they all should have been entered as "Physical Assoc." as well, not as -"Direct"- so I altered all interactions that were "Direct". Analysis of the Interaction between Globular Head Modules of Human C1q and Its Candidate Receptor gC1qR. Analysis of the Interaction between Globular Head Modules of Human C1q and Its Candidate Receptor gC1qR. Frontiers in immunology 2015 imex curation Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U., Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U. BLAT of primers shows that C1qR=Q07021 (C1QBP) interaction(s) not in Intact, although not dark space. berhane.ghebrehiwet@stonybrookmedicine.edu,uday.kishore@brunel.ac.uk,ukishore@hotmail.com 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U., Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U. BLAT of primers shows that C1qR=Q07021 (C1QBP) interaction(s) not in Intact, although not dark space. It is stated that monocyte-derived human macrophages were used;however no further treatment/purification is mentioned subsequent to Ficoll-paque density gradient isolation of PBMCs (peripheral blood mononuclear cells) . berhane.ghebrehiwet@stonybrookmedicine.edu,uday.kishore@brunel.ac.uk,ukishore@hotmail.com Accepted 2017-SEP-13 AT 11:54 BST AT 11:54 BST by PPORRAS Frontiers in immunology 2015 Only protein-protein interactions imex curation imex curation Yes - I think they all should have been entered as "Physical Assoc." as well, not as -"Direct"- so I altered all interactions that were "Direct". Analysis of the Interaction between Globular Head Modules of Human C1q and Its Candidate Receptor gC1qR. Analysis of the Interaction between Globular Head Modules of Human C1q and Its Candidate Receptor gC1qR. Frontiers in immunology 2015 imex curation Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U., Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U. BLAT of primers shows that C1qR=Q07021 (C1QBP) interaction(s) not in Intact, although not dark space. berhane.ghebrehiwet@stonybrookmedicine.edu,uday.kishore@brunel.ac.uk,ukishore@hotmail.com 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting antibody detection identification by antibody antibody detection Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U., Pednekar L., Pathan AA., Paudyal B., Tsolaki AG., Kaur A., Abozaid SM., Kouser L., Khan HA., Peerschke EI., Shamji MH., Stenbeck G., Ghebrehiwet B., Kishore U. BLAT of primers shows that C1qR=Q07021 (C1QBP) interaction(s) not in Intact, although not dark space. berhane.ghebrehiwet@stonybrookmedicine.edu,uday.kishore@brunel.ac.uk,ukishore@hotmail.com Accepted 2017-SEP-13 AT 11:54 BST AT 11:54 BST by PPORRAS Frontiers in immunology 2015 Only protein-protein interactions imex curation imex curation Yes - I think they all should have been entered as "Physical Assoc." as well, not as -"Direct"- so I altered all interactions that were "Direct". c1qb_human Complement C1q subcomponent subunit B C1QB protein protein human Homo sapiens Human MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA D80C753C0D430EDC c1qa_human Complement C1q subcomponent subunit A C1QA protein protein human Homo sapiens Human MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA DIP protein P02745 original sequence version: null 8FF6B6AE02D49C4C q07021-pro_0000018590 Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 ASF/SF2-associated protein p32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 gC1q-R protein p33 protein protein human Homo sapiens Human LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ 74 282 1C491151D53345A4 c1qc_human Complement C1q subcomponent subunit C C1QC C1QG protein protein human Homo sapiens Human MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD FA17117EB7ABFC12 c1q_human-c1qbp-2 2 6 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B-1 c1qa-c1qbp-1 2 5 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B-2 c1qb-c1qbp-1 2 8 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B-3 c1q_human-c1qbp-3 2 26 unspecified role unspecified role bait bait human-plasma homo sapiens blood plasma plasma blood plasma 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association 3A c1qa-c1qbp-2 4 6 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 3C-1 c1qb-c1qbp-2 4 5 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 3C-2 c1qc-c1qbp-1 4 8 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 3C-3 c1qa-c1qbp-3 2 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02745:p.Arg185Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:28:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg185ala' Tue Jun 30 18:10:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg185Ala' P02745:p.Arg185Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:08:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg185glu' Tue Jun 30 17:55:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg185Glu' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4A c1qbp-c1qa-1 2 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02746:p.Arg141Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 18:00:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg141gln' Tue Jun 30 16:05:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg141Gln' P02746:p.Arg141Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:55:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg141ala' Tue Jun 30 18:50:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg141Ala' P02746:p.His144Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain H D Wed May 02 20:04:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his144asp' Tue Jun 30 16:10:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His144Asp' P02746:p.Arg156Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:10:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg156ala' Tue Jun 30 17:32:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg156Ala' P02746:p.Arg156Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 17:34:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg156glu' Tue Jun 30 17:09:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg156Glu' P02746:p.Arg190Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 18:04:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg190glu' Tue Jun 30 19:33:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg190Glu' P02746:p.Thr204Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T L Wed May 02 18:51:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr204leu' Tue Jun 30 18:21:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr204Leu' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B The mutation T175L has been entered as T204L as there is no "T" at position 175/202. c1qbp-c1qa-2 2 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02747:p.Arg184Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 16:11:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg184glu' Tue Jun 30 17:24:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg184Glu' P02747:p.His129Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H A Wed May 02 20:29:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his129ala' Tue Jun 30 19:50:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His129Ala' P02747:p.Lys198Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:17:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys198glu' Tue Jun 30 19:21:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys198Glu' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4C The L170E mutation has been entered as K170E as there is no "L" at residue 170/198. c1qbp-c1qa-3 4 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02745:p.Arg185Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:38:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg185ala' Tue Jun 30 19:46:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg185Ala' P02745:p.Arg185Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 14:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg185glu' Tue Jun 30 19:41:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg185Glu' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4D c1qa-c1qbp-4 3 6 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 5 c1qb-c1qbp-3 3 5 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 5 c1qc-c1qbp-2 3 8 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 5 c1q_human Complement component C1q complex C1q Complement 1q C1QA-C1QB-C1QC complex 6xC1QA:6xC1QB:6xC1QC 5 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 93 99 96 94 100 97 103 97 118 103 112 139 118 109 106 102 136 112 108 105 111 115 127 139 136 126 114 124 117 120 121 123 132 129 135 133 130 145 138 142 141 144 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Complement component C1q deficiency (C1QD) [MONDO:0013343]: a disorder caused by impaired activation of the complement classical pathway. It generally leads to severe immune complex disease with features of systemic lupus erythematosus and glomerulonephritis. coronavirus The complex comprises of six heterotrimeric collagen-like triple helices, formed from triplets of the A, B, and C chains, that associate in their N-terminal half to form a stalk, then diverge to form individual stems, each terminating in a C-terminal globular domain. Each of the six heterotrimeric globular heads or domains is made up of the globular domains from one A, one B, and one C chain, each of which in turn has its own ligand specificity. The six collagen-like stalks appear to be fibril-like and exist in the central region. The collagen-like region and the globular heads can independently interact with a multiplicity of biological structures including pathogen-associated and cell associated molecules, also each of the individual globular head domains is capable of independently interacting with specific ligands. Chains A and B are disulfide-linked whilst the C chain forms a disulfide bond with the C chain of the next strand. Molecular weight 460 kDa. Recognition unit of the classical pathway of complement which associates with the Ca2+ - dependent C1r(2)-C1s(2) tetramer to form C1 (CPX-1920), the first component of the classical complement system. The complex's role in C1 is the recognition of immune complexes, or other molecules, which trigger the classical pathway of the complement system. Independent of complement activation C1q appears to have additional roles in homeostasis and cellular development, superoxide (O2-) production by neutrophils, blood coagulation and neurological synapse pruning. Heterooctadecamer created with intact-jami-dbscripts