UniProt UniProt http://www.uniprot.org Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. American journal of human genetics 2017 imex curation Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu Accepted 2017-MAY-22 AT 08:48 BST AT 08:48 BST by ORCHARD American journal of human genetics 2017 imex curation Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. American journal of human genetics 2017 imex curation Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-vsmc Homo sapiens aortic vascular smooth muscle cells vsmc Human aortic vascular smooth muscle cells confocal microscopy confocal microscopy immunostaining immunostaining Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu Accepted 2017-MAY-22 AT 08:48 BST AT 08:48 BST by ORCHARD American journal of human genetics 2017 imex curation Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. American journal of human genetics 2017 imex curation Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-vsmc Homo sapiens aortic vascular smooth muscle cells vsmc Human aortic vascular smooth muscle cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu Accepted 2017-MAY-22 AT 08:48 BST AT 08:48 BST by ORCHARD American journal of human genetics 2017 imex curation Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease. American journal of human genetics 2017 imex curation Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. Origin of transfected INO80E according Ref. 12 (PMID 17721549, and ADDGENE) dianna.m.milewicz@uth.tmc.edu Accepted 2017-MAY-22 AT 08:48 BST AT 08:48 BST by ORCHARD American journal of human genetics 2017 imex curation in80c_human INO80 complex subunit C INO80C C18orf37 IES6 homolog protein protein human Homo sapiens Human MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP 6EED290EB9E4E68E tyy1_human Transcriptional repressor protein YY1 Yin and yang 1 Delta transcription factor NF-E1 YY1 INO80S INO80 complex subunit S protein protein human Homo sapiens Human MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ DIP protein P25490 original sequence version: 153 058C05A0AD2D04E6 in80e_human INO80 complex subunit E CCDC95 Coiled-coil domain-containing protein 95 INO80E protein protein human Homo sapiens Human MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE F329B39D0F3EB253 yyap1_human YY1-associated protein 1 YY1AP1 HCCA2 YY1AP Hepatocellular carcinoma susceptibility protein Hepatocellular carcinoma-associated protein 2 protein protein human Homo sapiens Human MEEEASRSAAATNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDLFETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMYPELLPVCSLKAKNPQDKILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDQGLEKDNSELGSETRYPLLLPKGVVLKLKPVADRFPKKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAMPPEARTSFPLSESQTLLSSAPVPKVMMPSPASSMFRKPYVRRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPIATLLVNPTSFPCPLNQPLVASSVSPLIVSGNSVNLPIPSTPEDKAHMNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGFL A2FC8B4DBA8DFDA7 ruvb1_human RuvB-like 1 RUVBL1 NMP238 TIP49 TIP49A 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 Nuclear matrix protein 238 54 kDa erythrocyte cytosolic protein INO80H TIP60-associated protein 54-alpha INO80 complex subunit H protein protein human Homo sapiens Human MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK DIP protein Q9Y265 original sequence version: 82 DIP protein Q9Y265 original sequence version: 110 6095ADE692B1482B ino80e-ruvbl1-1 4 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 3A yy1-yy1ap1-8 2 6 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 3D yy1ap1-ino80c-1 3 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 3C yy1-yy1ap1-1 1 6 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 3B