IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu Accepted 2017-OCT-03 AT 10:44 BST AT 10:44 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation No I cant find it either - I was using the other peptide for some reason (YNKKKATVQELD)- I have removed the mutation and altered the peptide short label to "region" from "variant" (I have added Exp. Preps throughout - including here - mainly as "over-expressed" - although no idea what to add for the SEB peptide; mutation/variant removed as before. Isoform entered as -3 as this is the top hit (lowest E-value) on blasting aas 20-239 for AAB03814. For Isoform 1 the numbering is different (26-245) so I stuck with the suppliers (R+D) amd methods section numbering. (both sequences have the same one aa mismatch) As for Exp. Prep I have added "over-expressed" for the NSO myeloma cell line, as this is the most likely candidate but I have no idea what to add for the peptide - maybe "naturally occurring"? ; I think I have removed all the SEB mutations and altered variant to "region"; have added Exp. prep as "over-expressed" for both.; altered Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. Primers from Ref 12 (and PMID: 2825196 for Cd28 cDNA) show that CD28-GFP is isoform 1 and full length. kaempfer@hebrew.edu Accepted 2017-OCT-03 AT 10:44 BST AT 10:44 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation No I cant find it either - I was using the other peptide for some reason (YNKKKATVQELD)- I have removed the mutation and altered the peptide short label to "region" from "variant" (I have added Exp. Preps throughout - including here - mainly as "over-expressed" - although no idea what to add for the SEB peptide; mutation/variant removed as before. Isoform entered as -3 as this is the top hit (lowest E-value) on blasting aas 20-239 for AAB03814. For Isoform 1 the numbering is different (26-245) so I stuck with the suppliers (R+D) amd methods section numbering. (both sequences have the same one aa mismatch) As for Exp. Prep I have added "over-expressed" for the NSO myeloma cell line, as this is the most likely candidate but I have no idea what to add for the peptide - maybe "naturally occurring"? ; I think I have removed all the SEB mutations and altered variant to "region"; have added Exp. prep as "over-expressed" for both.; altered Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu Accepted 2017-OCT-03 AT 10:44 BST AT 10:44 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation No I cant find it either - I was using the other peptide for some reason (YNKKKATVQELD)- I have removed the mutation and altered the peptide short label to "region" from "variant" (I have added Exp. Preps throughout - including here - mainly as "over-expressed" - although no idea what to add for the SEB peptide; mutation/variant removed as before. Isoform entered as -3 as this is the top hit (lowest E-value) on blasting aas 20-239 for AAB03814. For Isoform 1 the numbering is different (26-245) so I stuck with the suppliers (R+D) amd methods section numbering. (both sequences have the same one aa mismatch) As for Exp. Prep I have added "over-expressed" for the NSO myeloma cell line, as this is the most likely candidate but I have no idea what to add for the peptide - maybe "naturally occurring"? ; I think I have removed all the SEB mutations and altered variant to "region"; have added Exp. prep as "over-expressed" for both.; altered Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. Figure 2A:It is stated:- "B7-2 having GFP fused C-terminally to its intracellular domain". However primer sequences do not unambiguously confirm that the intracellular domain was used. kaempfer@hebrew.edu Accepted 2017-OCT-03 AT 10:44 BST AT 10:44 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation No I cant find it either - I was using the other peptide for some reason (YNKKKATVQELD)- I have removed the mutation and altered the peptide short label to "region" from "variant" (I have added Exp. Preps throughout - including here - mainly as "over-expressed" - although no idea what to add for the SEB peptide; mutation/variant removed as before. Isoform entered as -3 as this is the top hit (lowest E-value) on blasting aas 20-239 for AAB03814. For Isoform 1 the numbering is different (26-245) so I stuck with the suppliers (R+D) amd methods section numbering. (both sequences have the same one aa mismatch) As for Exp. Prep I have added "over-expressed" for the NSO myeloma cell line, as this is the most likely candidate but I have no idea what to add for the peptide - maybe "naturally occurring"? ; I think I have removed all the SEB mutations and altered variant to "region"; have added Exp. prep as "over-expressed" for both.; altered Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Superantigens hyperinduce inflammatory cytokines by enhancing the B7-2/CD28 costimulatory receptor interaction. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. Fig 3: "abutted means "be next to or have a common boundary with" The SMEZ protein has been entered from the Reference Proteome as no strain is stated. kaempfer@hebrew.edu Accepted 2017-OCT-03 AT 10:44 BST AT 10:44 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation No I cant find it either - I was using the other peptide for some reason (YNKKKATVQELD)- I have removed the mutation and altered the peptide short label to "region" from "variant" (I have added Exp. Preps throughout - including here - mainly as "over-expressed" - although no idea what to add for the SEB peptide; mutation/variant removed as before. Isoform entered as -3 as this is the top hit (lowest E-value) on blasting aas 20-239 for AAB03814. For Isoform 1 the numbering is different (26-245) so I stuck with the suppliers (R+D) amd methods section numbering. (both sequences have the same one aa mismatch) As for Exp. Prep I have added "over-expressed" for the NSO myeloma cell line, as this is the most likely candidate but I have no idea what to add for the peptide - maybe "naturally occurring"? ; I think I have removed all the SEB mutations and altered variant to "region"; have added Exp. prep as "over-expressed" for both.; altered p06886-pro_0000035619 Toxic shock syndrome toxin-1 tst protein protein staau Staphylococcus aureus STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 41 234 6D9A0A8242AA28A7 etxb_staau Enterotoxin type B entB SEB protein protein staau Staphylococcus aureus MYKRLFISHVILIFALILVISTPNVLAESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK DIP protein P01552 original sequence version: 87 B6D417F61CF018B0 p42081-3 T-lymphocyte activation antigen CD86 CD86 CD28LG2 Activation B7-2 antigen B70 BU63 CTLA-4 counter-receptor B7.2 FUN-1 protein protein human Homo sapiens Human MGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF DIP protein P42081-3 original sequence version: 118 p42081-1 T-lymphocyte activation antigen CD86 CD86 CD28LG2 Activation B7-2 antigen B70 BU63 CTLA-4 counter-receptor B7.2 FUN-1 protein protein human Homo sapiens Human MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF C249DAEEB889D911 q99xw1_strp1 smeZ SPy_1998 protein protein strp1 Streptococcus pyogenes serotype M1 MKKTKLIFSFTSIFIAIISRPVFGLEVDNNSLLRNIYSTIVYEYSDTVIDFKTSHNLVTKKLDVRDARDFFINSEMDEYAANDFKDGDKIAMFSVPFDWNYLSEGKVIAYTYGGMTPYQEEPMSKNIPVNLWINRKQIPVPYNQISTNKTTVTAQEIDLKVRKFLISQHQLYSSGSSYKSGKLVFHTNDNSDKYSLDLFYVGYRDKESIFKVYKDNKSFNIDKIGHLDIEIDS E9A8C3811ECA01F9 p10747-1 T-cell-specific surface glycoprotein CD28 CD28 TP44 protein protein human Homo sapiens Human MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS DIP protein P10747-1 original sequence version: 124 12c 12C peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) CYNKKKATVQELDC SEB derivative:P01552 cd86-entb-1 4 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region (intracellular_domain) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization 2A Colocalization of SEB with cell-surface B7-2 cd86-entb-2 1 7 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 2B cd86-entb-3 5 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role prey prey purified purified c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 2C entb-cd86-1 3 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P01552:p.[Thr177Ala;Lys179Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:18:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr177ala,lys179ala' Tue Jun 30 18:41:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr177Ala;Lys179Ala]' chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 2D entb-cd86-2 5 8 unspecified role unspecified role prey prey purified purified c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 12 unspecified role unspecified role bait bait purified purified 12c:p.[Tyr2Ala;Lys4Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:38:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr2ala,lys4ala' Tue Jun 30 15:42:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr2Ala;Lys4Ala]' 12c:p.[Lys4Ala;Asp13Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:11:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys4ala,asp13ala' Tue Jun 30 16:19:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys4Ala;Asp13Ala]' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 3 A/C entb-cd86-3 5 7 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role bait bait purified purified pB2-4 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 5A, Table S1 cd86-entb-4 5 7 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role bait bait purified purified pB2-6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 5B, Table S1 cd86-entb-5 5 6 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified pB2-4 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp fig 4 A, Table S1 cd86-entb-6 5 6 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified pB2-6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp fig 4B, Table S1 cd86-tst-1 5 10 unspecified role unspecified role prey prey purified purified mature_protein sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified pB2-4 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp fig 4 C, Table S1 cd86-tst-2 5 10 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mature_protein sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified pB2-6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp fig 4D, Table S1 cd28-cd86-2 2 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ig_like_domain required to bind necessary binding region required to bind range range range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 7F-J, Supp fig 6 SEB; however the SEB tk2 mutant did not have any agonistic effect. The B7-2C splice variant did not bind CD28. From Ref 18 Figure 1A, this variant is missing the first "Ig like domain", so this variant might correspond to P42081-5. I could not match B7-2C sequence exactly - I dont know what the full length protein is meant to be - it has 972bp=324 aas - no protein with this length (has ever been??) in UniProt...