DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Nature 2016 imex curation Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. DIP original experiment: DIP-269089X Nature 2016 IMEx Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Nature 2016 imex curation Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. DIP original experiment: DIP-269088X Nature 2016 IMEx Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Nature 2016 imex curation Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. DIP original experiment: DIP-269086X Nature 2016 IMEx Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. Nature 2016 imex curation Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tao G., Kahr PC., Morikawa Y., Zhang M., Rahmani M., Heallen TR., Li L., Sun Z., Olson EN., Amendt BA., Martin JF. DIP original experiment: DIP-269087X Nature 2016 IMEx Pitx2 promotes heart repair by activating the antioxidant response after cardiac injury. nf2l2_mouse Nuclear factor erythroid 2-related factor 2 Nuclear factor, erythroid derived 2, like 2 Nfe2l2 Nrf2 protein protein mouse Mus musculus Mouse MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQEKAFFAQFQLDEETGEFLPIQPAQHIQTDTSGSASYSQVAHIPKQDALYFEDCMQLLAETFPFVDDHESLALDIPSHAESSVFTAPHQAQSLNSSLEAAMTDLSSIEQDMEQVWQELFSIPELQCLNTENKQLADTTAVPSPEATLTEMDSNYHFYSSISSLEKEVGNCGPHFLHGFEDSFSSILSTDDASQLTSLDSNPTLNTDFGDEFYSAFIAEPSDGGSMPSSAAISQSLSELLDGTIEGCDLSLCKAFNPKHAEGTMEFNDSDSGISLNTSPSRASPEHSVESSIYGDPPPGFSDSEMEELDSAPGSVKQNGPKAQPAHSPGDTVQPLSPAQGHSAPMRESQCENTTKKEVPVSPGHQKAPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVDDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLGHLKDEREKLLREKGENDRNLHLLKRRLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDTKKN DIP protein Q60795 original sequence version: 143 6128707C82CAE239 pitx2_mouse Pituitary homeobox 2 BRX1 homeoprotein Paired-like homeodomain transcription factor Munc 30 Pitx2 Arp1 Brx1 Otlx2 Ptx2 Rgs Orthodenticle-like homeobox 2 Solurshin ALL1-responsive protein ARP1 Paired-like homeodomain transcription factor 2 Homeobox protein PITX2 protein protein mouse Mus musculus Mouse METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPKSRKESASSKLFPRQHPGANEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV DIP protein P97474 original sequence version: 151 188315708E6BD95D yap1_mouse Transcriptional coactivator YAP1 Yap1 Yap Yap65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein mouse Mus musculus Mouse MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTASGVVSGPAAAPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQAIRNINPSTANAPKCQELALRSQLPTLEQDGGTPNAVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL DIP protein P46938 original sequence version: 120 DIP protein P46938 original sequence version: 124 DIP protein P46938 original sequence version: 137 DIP protein P46938 original sequence version: 101 5A2221B74B1400F9 pitx2-yap1-1 2 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse physical association physical association pitx2-yap1-2 3 7 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 86-144 Region 86-144 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nfe2l2-pitx2-1 1 5 unspecified role unspecified role bait bait mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association pitx2-nfe2l2-1 4 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse physical association physical association