DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Nature 2016 imex curation Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. DIP original experiment: DIP-268758X Nature 2016 IMEx Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Nature 2016 imex curation Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. DIP original experiment: DIP-268757X Nature 2016 IMEx Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Nature 2016 imex curation Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. DIP original experiment: DIP-268759X Nature 2016 IMEx Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. Nature 2016 imex curation Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou Z., Tang AT., Wong WY., Bamezai S., Goddard LM., Shenkar R., Zhou S., Yang J., Wright AC., Foley M., Arthur JS., Whitehead KJ., Awad IA., Li DY., Zheng X., Kahn ML. DIP original experiment: DIP-268760X Nature 2016 IMEx Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling. pdc10_human Programmed cell death protein 10 PDCD10 CCM3 TFAR15 TF-1 cell apoptosis-related protein 15 Cerebral cavernous malformations 3 protein protein protein human Homo sapiens Human MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA DIP protein Q9BUL8 original sequence version: 96 DIP protein Q9BUL8 original sequence version: 125 5AA613F71FAAEF56 q9bsq5-1 Cerebral cavernous malformations 2 protein CCM2 C7orf22 Malcavernin PP10187 protein protein human Homo sapiens Human MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDIEALGCSMDQDSA DIP protein Q9BSQ5-1 original sequence version: 117 DIP protein Q9BSQ5-1 original sequence version: 125 krit1_human Krev interaction trapped protein 1 KRIT1 CCM1 Cerebral cavernous malformations 1 protein protein protein human Homo sapiens Human MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQGNSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDNTKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRPSPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGDSELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLHFAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS DIP protein O00522 original sequence version: 156 D11F75ED629E85AC m3k3_human Mitogen-activated protein kinase kinase kinase 3 MAP3K3 MAPKKK3 MEKK3 MAPK/ERK kinase kinase 3 protein protein human Homo sapiens Human MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLMY DIP protein Q99759 original sequence version: 164 DIP protein Q99759-1 original sequence version: 173 28129168A57571DD ccm2-krit1-6 3 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 5 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association ccm2-krit1-7 2 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association ccm2-map3k3-5 1 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association ccm2-map3k3-6 4 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 280-444 Region 280-444 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-373 Region 1-373 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association