DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269047X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269053X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269052X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269051X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269035X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269046X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269028X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269038X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269041X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269049X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269055X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269042X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269027X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269044X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269036X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269029X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269050X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269054X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269043X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269034X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269032X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269037X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269030X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269033X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269045X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269048X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269039X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269031X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. A DNA topoisomerase VI-like complex initiates meiotic recombination. Science (New York, N.Y.) 2016 imex curation Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vrielynck N., Chambon A., Vezon D., Pereira L., Chelysheva L., De Muyt A., Mézard C., Mayer C., Grelon M. DIP original experiment: DIP-269040X Science (New York, N.Y.) 2016 IMEx A DNA topoisomerase VI-like complex initiates meiotic recombination. spo12_arath Meiotic recombination protein SPO11-2 SPO11-2 At1g63990 F22C12.24 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEESSGLSSMKFFSDQHLSYADILLPHEARARIEVSVLNLLRILNSPDPAISDLSLINRKRSNSCINKGILTDVSYIFLSTSFTKSSLTNAKTAKAFVRVWKVMEICFQILLQEKRVTQRELFYKLLCDSPDYFSSQIEVNRSVQDVVALLRCSRYSLGIMASSRGLVAGRLFLQEPGKEAVDCSACGSSGFAITGDLNLLDNTIMRTDARYIIIVEKHAIFHRLVEDRVFNHIPCVFITAKGYPDIATRFFLHRMSTTFPDLPILVLVDWNPAGLAILCTFKFGSIGMGLEAYRYACNVKWIGLRGDDLNLIPEESLVPLKPKDSQIAKSLLSSKILQENYIEELSLMVQTGKRAEIEALYCHGYNYLGKYIATKIVQGKYI DIP protein Q9M4A1 original sequence version: 109 08AB5FA102A1F189 top6b_arath DNA topoisomerase 6 subunit B TOP6B At3g20780 BIN3 HYP6 RHL3 Protein BRASSINOSTEROID INSENSITIVE 3 Protein ROOT HAIRLESS 3 Protein ELONGATED HYPOCOTYL 6 MOE17.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGDDLVETKKGSSKNSKDSNESKLKQKSPAEFFAENKNIAGFDNPGKSLYTTVRELVENALDSAESISELPEVEVTIEEIVKSKFNSMIGLIDRERVDTQLYDDYETEKARGKRLAKEARASEIQAKNLASGKKNKEPGVSKVLKARGEASYYKVTCKDNGKGMPHDDIPNMFGRVLSGTKYGLKQTRGKFGLGAKMALIWSKMSTGLPIEISSSMKSQNYVTFCRLDIDIHRNIPHIHLHEKKGNKEKWHGAEIQVVIEGNWTTYRSKILHYMRQMAVITPYAQFLFRFISETPEKNVTIKFTRRTDVMPPIPIETKHHPSSVDLLLIKRLITDTSKKTLLQFLQNEFVNINKTLAARLIGEMGPDFGPSMAVKSVTSQQMVRIHQLFRQAKFDDPSGDCLSPAGEYNLRLGIIKELHPDMVATYSGSAQVFEGHPFIVEAGVSLGGRDVKQGINIFRFANRIPLLFEQGADVVTRTALKRINWNSYKINQTQDKIGVFVSIVSTKIPFKGTGKEYIGDDISEIATAVKSAIQQCCIQLKSKIVKRLQAREQQERKRSLSRYIPDATGAVYEVLKQMTEEHKTKRKRYGEEDIVMLDKVSKQIITKETLKEKLAEHVEQVDYEMALEYATQSGVSEEPRENIYLQHLDPNKSNFIDLHSPTFVFRLML DIP protein Q9C5V6 original sequence version: 96 5735F0A6B4578D61 spo11_arath Meiotic recombination protein SPO11-1 SPO11-1 MJG19.19 At3g13170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGKFAISESTNLLQRIKDFTQSVVVDLAEGRSPKISINQFRNYCMNPEADCLCSSDKPKGQEIFTLKKEPQTYRIDMLLRVLLIVQQLLQENRHASKRDIYYMHPSAFKAQSIVDRAIGDICILFQCSRYNLNVVSVGNGLVMGWLKFREAGRKFDCLNSLNTAYPVPVLVEEVEDIVSLAEYILVVEKETVFQRLANDMFCKTNRCIVITGRGYPDVSTRRFLRLLMEKLHLPVHCLVDCDPYGFEILATYRFGSMQMAYDIESLRAPDMKWLGAFPSDSEVYSVPKQCLLPLTEEDKKRTEAMLLRCYLKREMPQWRLELETMLKRGVKFEIEALSVHSLSFLSEVYIPSKIRREVSSP DIP protein Q9M4A2 original sequence version: 114 AE82942C4F456770 to6bl_arath Type 2 DNA topoisomerase 6 subunit B-like MTOPVIB Meiotic topoisomerase VIB-like F8A5.1 At1g60460 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENNAPVPKLLLQLISSAFQRCRLAEDLCRLSVLLDQSTERDPPITCISIADTGIGCNLEEFQNLRCPREFNGAKIWDGLLSVKTTCFTDDEVYYYHINLDEYIANKRLKRQPSQAKNGAKFSGTEVSLSVFGSMDVLVAPIIGFFQKIIVLQILNVTLDLMVKQGTSPGNQTQYVFAVNADKTPCFTASNLERLKSGLEDYVLRHANCLDTMCDYCFSDREHLKVGSGTVCQEDKHKRVGGTMEVVIVISDLLESTQHCSRSCNGKTEVLYFDNFLPSPVPHLALSALKKIDWKKYGLILANVNDQDGHVFLEWDNFPSYVQIQIALHWYHNQYPTRQKNGPGISLLKKGIKNALDNLKAKHEGFLLSSHSRKICSYVPDLARSIAGLIFSSTDLDFQGDCLSVLGFQTQEVERDTVENYIQRKIVTVIGMNERKPQKDQEAAPFLFFDGESETSFFEDEEVEGEYYSSSLE This sequence has been withdrawn from Uniprot. 509E9B3E2EA77328 top6a_arath DNA topoisomerase 6 subunit A TOP6A SPO11-3 BIN5 At5g02820 RHL2 Protein BRASSINOSTEROID INSENSITIVE 5 Protein ROOT HAIRLESS 2 Meiotic recombination protein SPO11-3 F9G14.130 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADKKKRKRSKDDEAEELPFKSILESDDVITELLKSYISSSIKAAAGAGGASSSSSKPLTLADLSLSSSCREVADLSLSSVQTEIETVIVQIARSILAGDGFSFSVPSRAASNQLYVPELDRIVLKDKSTLRPFASVSSVRKTTITTRILALIHQLCLRNIHVTKRDLFYTDVKLFQDQTQSDAVLDDVSCMLGCTRSSLNVIAAEKGVVVGRLIFSDNGDMIDCTKMGMGGKAIPPNIDRVGDMQSDAMFILLVEKDAAYMRLAEDRFYNRFPCIIVTAKGQPDVATRLFLRKMKMELKLPVLALVDSDPYGLKILSVYGCGSKNMSYDSANLTTPDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDMLEEDFVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL DIP protein Q9LZ03 original sequence version: 105 0EA41B8B4BA77441 mtopvib-top6a-1 18 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role bait bait Region 345-493 Region 345-493 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mtopvib-spo11_1-1 13 32 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-180 Region 1-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nicbe Nicotiana benthamiana 33 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 183-493 Region 183-493 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association top6a-top6b-6 15 31 unspecified role unspecified role prey prey Region 321-670 Region 321-670 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association top6a-mtopvib-1 5 34 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role prey prey Region 345-493 Region 345-493 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_2-spo11_1-1 6 32 unspecified role unspecified role prey prey Region 1-54 Region 1-54 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mtopvib-top6a-2 14 34 unspecified role unspecified role prey prey Region 1-248 Region 1-248 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association top6a-top6b-7 22 31 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role bait bait Region 1-248 Region 1-248 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mtopvib-spo11_2-1 7 30 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 33 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association mtopvib-spo11_2-2 2 30 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role bait bait Region 345-493 Region 345-493 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mtopvib-spo11_1-2 25 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role bait bait Region 345-493 Region 345-493 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association top6a-top6a-1 8 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_1-spo11_2-1 16 30 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 32 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association mtopvib-spo11_1-3 26 32 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 33 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association top6b-top6a-3 11 31 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role prey prey Region 1-248 Region 1-248 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_1-mtopvib-1 23 32 unspecified role unspecified role bait bait Region 1-180 Region 1-180 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-54 Region 1-54 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_1-spo11_2-2 1 32 unspecified role unspecified role bait bait Region 1-54 Region 1-54 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_2-spo11_1-2 27 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role bait bait Region 1-77 Region 1-77 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_1-mtopvib-2 28 32 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role prey prey Region 345-493 Region 345-493 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_1-spo11_2-3 29 32 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role prey prey Region 1-77 Region 1-77 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mtopvib-spo11_2-3 17 30 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-208 Region 1-208 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nicbe Nicotiana benthamiana 33 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 183-493 Region 183-493 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association spo11_2-mtopvib-1 21 30 unspecified role unspecified role bait bait Region 1-208 Region 1-208 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-22 Region 1-22 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association top6b-top6a-4 9 31 unspecified role unspecified role bait bait Region 321-670 Region 321-670 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mtopvib-spo11_2-4 10 30 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 33 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association spo11_2-mtopvib-2 24 30 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role prey prey Region 345-493 Region 345-493 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_1-spo11_2-4 3 30 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 32 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association mtopvib-spo11_1-4 12 32 unspecified role unspecified role prey prey Region 1-180 Region 1-180 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-54 Region 1-54 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association top6a-mtopvib-2 20 34 unspecified role unspecified role bait bait Region 1-248 Region 1-248 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association spo11_1-spo11_2-5 4 30 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 32 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association mtopvib-spo11_2-5 19 30 unspecified role unspecified role prey prey Region 1-208 Region 1-208 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-22 Region 1-22 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association