DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268430X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268434X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268424X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268428X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268426X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268429X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268433X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268431X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268425X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268421X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268427X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268422X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268432X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Structure (London, England : 1993) 2016 imex curation Dawidowski D., Cafiso DS. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268423X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. stxb1_rat Syntaxin-binding protein 1 Stxbp1 Unc18a Protein unc-18 homolog 1 Protein unc-18 homolog A N-Sec1 rbSec1 p67 protein protein rat Rattus norvegicus (Rat) Rat MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS DIP protein P61765 original sequence version: 98 DIP protein P61765-1 original sequence version: 86 DIP protein P61765-1 original sequence version: 79 DIP protein P61765 original sequence version: 116 2DD0715F875CE0F3 stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein P32851 original sequence version: 74 DIP protein P32851 original sequence version: 78 DIP protein P32851 original sequence version: 142 DIP protein P32851 original sequence version: 138 DIP protein P32851 original sequence version: 89 DIP protein P32851 original sequence version: 115 DIP protein P32851 original sequence version: 134 DIP protein P32851 original sequence version: 121 DIP protein P32851 original sequence version: 123 DIP protein P32851 original sequence version: 150 DIP protein P32851 original sequence version: 156 DIP protein P32851 original sequence version: 163 DIP protein P32851 original sequence version: 126 DIP protein P32851 original sequence version: 124 DIP protein P32851 original sequence version: 158 8F929F489E323CAA snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881 original sequence version: 105 DIP protein P60881 original sequence version: 40 DIP protein P60881 original sequence version: 106 DIP protein P60881 original sequence version: 78 DIP protein P60881 original sequence version: 75 DIP protein P60881 original sequence version: 100 DIP protein P60881 original sequence version: 120 DIP protein P60881 original sequence version: 131 DIP protein P60881 original sequence version: 93 FBED2B082A4CB6A6 snap25-stx1a-25 2 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction stx1a-1 10 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-26 1 17 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-31 5 17 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-32 12 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-33 8 17 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-34 11 17 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-35 14 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction stx1a-stxbp1-20 13 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-36 4 17 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-37 3 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction stx1a-stxbp1-21 7 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-38 6 17 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-stx1a-39 9 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction