DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268595X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268587X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268598X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268593X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions bovin Bos taurus (Bovine) Bovine molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268585X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268594X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268592X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268599X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268583X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions bovin Bos taurus (Bovine) Bovine 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268582X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268597X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268584X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268581X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268586X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268596X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268589X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268600X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268588X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268591X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Structure of transcribing mammalian RNA polymerase II. Nature 2016 imex curation Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bernecky C., Herzog F., Baumeister W., Plitzko JM., Cramer P. DIP original experiment: DIP-268590X Nature 2016 IMEx Structure of transcribing mammalian RNA polymerase II. rpb3_bovin DNA-directed RNA polymerase II subunit RPB3 POLR2C DNA-directed RNA polymerase II subunit C protein protein bovin Bos taurus (Bovine) Bovine MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN DIP protein Q3T0Q3 original sequence version: 71 DIP protein Q3T0Q3 original sequence version: 81 a5pjw8_bovin DNA-directed RNA polymerase subunit beta POLR2B protein protein bovin Bos taurus (Bovine) Bovine MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV DIP protein A5PJW8 original sequence version: 62 DIP protein A5PJW8 original sequence version: 74 rpb11_bovin DNA-directed RNA polymerase II subunit RPB11 POLR2J DNA-directed RNA polymerase II subunit J protein protein bovin Bos taurus (Bovine) Bovine MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE DIP protein Q32P79 original sequence version: 67 DIP protein Q32P79 original sequence version: 75 f2z4h3_bovin DNA-directed RNA polymerases I, II, and III subunit RPABC3 POLR2H protein protein bovin Bos taurus (Bovine) Bovine MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF DIP protein F2Z4H3 original sequence version: 29 DIP protein F2Z4H3 original sequence version: 39 rpab4_bovin DNA-directed RNA polymerases I, II, and III subunit RPABC4 POLR2K DNA-directed RNA polymerase II subunit K protein protein bovin Bos taurus (Bovine) Bovine MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR DIP protein Q3ZBC0 original sequence version: 68 DIP protein Q3ZBC0 original sequence version: 78 p0cap2-1 DNA-directed RNA polymerase II subunit GRINL1A POLR2M GRINL1A DNA-directed RNA polymerase II subunit M Glutamate receptor-like protein 1A Gdown1 protein protein human Homo sapiens Human MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRRKSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGDEETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDDDWSSDEF DIP protein P0CAP2-1 original sequence version: 59 g3mzy8_bovin DNA-directed RNA polymerase subunit POLR2A protein protein bovin Bos taurus (Bovine) Bovine MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDDEN DIP protein G3MZY8 original sequence version: 20 DIP protein G3MZY8 original sequence version: 32 6876FD95692A657E rpb7_bovin DNA-directed RNA polymerase II subunit RPB7 POLR2G DNA-directed RNA polymerase II subunit G protein protein bovin Bos taurus (Bovine) Bovine MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS DIP protein Q5E9B8 original sequence version: 66 DIP protein Q5E9B8 original sequence version: 76 q1jq91_bovin POLR2D protein protein bovin Bos taurus (Bovine) Bovine MAAGGSDPRSGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY DIP protein Q1JQ91 original sequence version: 63 DIP protein Q1JQ91 original sequence version: 72 spt4h_human Transcription elongation factor SPT4 DRB sensitivity-inducing factor small subunit DRB sensitivity-inducing factor 14 kDa subunit SUPT4H1 SPT4H SUPT4H protein protein human Homo sapiens Human MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT DIP protein P63272 original sequence version: 96 DIP protein P63272 original sequence version: 114 09EDF007501D0F03 rpab1_bovin DNA-directed RNA polymerases I, II, and III subunit RPABC1 POLR2E DNA-directed RNA polymerase II subunit E RPB5 homolog protein protein bovin Bos taurus (Bovine) Bovine MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDGLDQTLEEFKAQFGGKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ DIP protein Q2T9T3 original sequence version: 57 DIP protein Q2T9T3 original sequence version: 64 rpab5_bovin DNA-directed RNA polymerases I, II, and III subunit RPABC5 POLR2L DNA-directed RNA polymerase III subunit L protein protein bovin Bos taurus (Bovine) Bovine MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK DIP protein Q32P78 original sequence version: 75 DIP protein Q32P78 original sequence version: 84 rpab2_bovin DNA-directed RNA polymerases I, II, and III subunit RPABC2 POLR2F DNA-directed RNA polymerase II subunit F RPB6 homolog protein protein bovin Bos taurus (Bovine) Bovine MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQVNVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD DIP protein Q32PE0 original sequence version: 63 DIP protein Q32PE0 original sequence version: 69 spt5h_human Transcription elongation factor SPT5 DRB sensitivity-inducing factor large subunit DRB sensitivity-inducing factor 160 kDa subunit Tat-cotransactivator 1 protein SUPT5H SPT5 SPT5H protein protein human Homo sapiens Human MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEEEDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA DIP protein O00267 original sequence version: 130 DIP protein O00267 original sequence version: 91 DIP protein O00267 original sequence version: 131 DIP protein O00267-1 original sequence version: 150 DIP protein O00267 original sequence version: 44 EC3F402A670A5B7D rpb9_bovin DNA-directed RNA polymerase II subunit RPB9 POLR2I DNA-directed RNA polymerase II subunit I protein protein bovin Bos taurus (Bovine) Bovine MEPDGTYEPGIVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE DIP protein Q32P73 original sequence version: 66 DIP protein Q32P73 original sequence version: 75 polr2b-supt5h-1 11 22 unspecified role unspecified role unspecified role unspecified role 820-CL 820-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 34 unspecified role unspecified role unspecified role unspecified role 331-CL 331-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-polr2b-2 4 27 unspecified role unspecified role unspecified role unspecified role 331-CL 331-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role 458-CL 458-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 815-CL 815-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine direct interaction direct interaction polr2a-polr2b-3 13 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 34 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 23 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 32 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 35 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 24 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 28 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 33 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 31 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 29 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 21 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 27 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine physical association physical association polr2a-polr2b-4 16 27 unspecified role unspecified role unspecified role unspecified role 212-CL 212-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role 327-CL 327-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 458-CL 458-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 815-CL 815-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 214-CL 214-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine direct interaction direct interaction polr2b-supt5h-2 14 22 unspecified role unspecified role unspecified role unspecified role 327-CL 327-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 332-CL 332-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 334-CL 334-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 34 unspecified role unspecified role unspecified role unspecified role 231-CL 231-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2b-supt5h-3 15 22 unspecified role unspecified role unspecified role unspecified role 327-CL 327-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 34 unspecified role unspecified role unspecified role unspecified role 236-CL 236-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-polr2b-5 7 27 unspecified role unspecified role unspecified role unspecified role 213-CL 213-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role 327-CL 327-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine direct interaction direct interaction polr2b-supt5h-4 8 22 unspecified role unspecified role unspecified role unspecified role 264-CL 264-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 34 unspecified role unspecified role unspecified role unspecified role 236-CL 236-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-polr2b-6 19 27 unspecified role unspecified role unspecified role unspecified role 1125-CL 1125-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 1135-CL 1135-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role 494-CL 494-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine direct interaction direct interaction polr2a-polr2e-1 1 31 unspecified role unspecified role unspecified role unspecified role 88-CL 88-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 27 unspecified role unspecified role unspecified role unspecified role 179-CL 179-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine direct interaction direct interaction polr2a-polr2b-7 12 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 23 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 32 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 35 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 24 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 28 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 33 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 31 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 29 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 21 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 27 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine physical association physical association polr2a-supt5h-1 17 27 unspecified role unspecified role unspecified role unspecified role 1866-CL 1866-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 34 unspecified role unspecified role unspecified role unspecified role 1037-CL 1037-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-polr2b-8 5 25 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 23 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 32 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 35 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 24 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 28 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 33 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 31 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 29 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 21 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 27 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine physical association physical association polr2a-supt5h-2 18 27 unspecified role unspecified role unspecified role unspecified role 212-CL 212-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 34 unspecified role unspecified role unspecified role unspecified role 231-CL 231-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 258-CL 258-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2b-supt5h-5 3 22 unspecified role unspecified role unspecified role unspecified role 815-CL 815-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 34 unspecified role unspecified role unspecified role unspecified role 333-CL 333-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-polr2b-9 20 27 unspecified role unspecified role unspecified role unspecified role 1219-CL 1219-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role 248-CL 248-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine direct interaction direct interaction supt4h1-supt5h-3 6 30 unspecified role unspecified role unspecified role unspecified role 118-CL 118-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 34 unspecified role unspecified role unspecified role unspecified role 268-CL 268-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 274-CL 274-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-polr2b-10 9 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 34 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 25 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 23 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 32 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 35 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 24 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 28 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 33 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 31 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 29 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 21 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 27 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine physical association physical association polr2a-polr2b-11 10 25 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 23 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 32 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 35 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 24 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 28 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 33 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 31 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 29 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 21 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 22 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 27 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine physical association physical association polr2a-polr2e-2 2 31 unspecified role unspecified role unspecified role unspecified role 186-CL 186-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 27 unspecified role unspecified role unspecified role unspecified role 132-CL 132-CL xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine direct interaction direct interaction