IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Cell metabolism 2016 imex curation Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease rouault@mail.nih.gov 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease same first author as pmid:24606901 - the one Lucasz is sittting on. [This publication:the word "Imex" cannot be found in main paper nor supplement! So I have added an Imex ID- had to do it manually on Imex Central website.] In gel SQR activity : not sure if there is anything I could annotate here, probably not - as cells/extracts used. Method is in Supplement of 2014 paper - which I could not access. (looks too complicated anyway.) mitochondrial lysates rouault@mail.nih.gov Accepted 2017-MAY-22 AT 11:56 BST AT 11:56 BST by ORCHARD Cell metabolism 2016 imex curation Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Cell metabolism 2016 imex curation Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease rouault@mail.nih.gov 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease same first author as pmid:24606901 - the one Lucasz is sittting on. [This publication:the word "Imex" cannot be found in main paper nor supplement! So I have added an Imex ID- had to do it manually on Imex Central website.] In gel SQR activity : not sure if there is anything I could annotate here, probably not - as cells/extracts used. Method is in Supplement of 2014 paper - which I could not access. (looks too complicated anyway.) Patient-derived fibroblasts and control cells were grown in the presence of Fe55-Transferrin. rouault@mail.nih.gov Accepted 2017-MAY-22 AT 11:56 BST AT 11:56 BST by ORCHARD Cell metabolism 2016 imex curation Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Cell metabolism 2016 imex curation Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease rouault@mail.nih.gov 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease same first author as pmid:24606901 - the one Lucasz is sittting on. [This publication:the word "Imex" cannot be found in main paper nor supplement! So I have added an Imex ID- had to do it manually on Imex Central website.] In gel SQR activity : not sure if there is anything I could annotate here, probably not - as cells/extracts used. Method is in Supplement of 2014 paper - which I could not access. (looks too complicated anyway.) HEK293 mitochondrial lysates rouault@mail.nih.gov Accepted 2017-MAY-22 AT 11:56 BST AT 11:56 BST by ORCHARD Cell metabolism 2016 imex curation Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Cell metabolism 2016 imex curation Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease rouault@mail.nih.gov 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease same first author as pmid:24606901 - the one Lucasz is sittting on. [This publication:the word "Imex" cannot be found in main paper nor supplement! So I have added an Imex ID- had to do it manually on Imex Central website.] In gel SQR activity : not sure if there is anything I could annotate here, probably not - as cells/extracts used. Method is in Supplement of 2014 paper - which I could not access. (looks too complicated anyway.) rouault@mail.nih.gov Accepted 2017-MAY-22 AT 11:56 BST AT 11:56 BST by ORCHARD Cell metabolism 2016 imex curation Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB. Cell metabolism 2016 imex curation Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease rouault@mail.nih.gov 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Maio N., Ghezzi D., Verrigni D., Rizza T., Bertini E., Martinelli D., Zeviani M., Singh A., Carrozzo R., Rouault TA. Rare diseases - Interactions investigated in the context of Rare genetic disease same first author as pmid:24606901 - the one Lucasz is sittting on. [This publication:the word "Imex" cannot be found in main paper nor supplement! So I have added an Imex ID- had to do it manually on Imex Central website.] In gel SQR activity : not sure if there is anything I could annotate here, probably not - as cells/extracts used. Method is in Supplement of 2014 paper - which I could not access. (looks too complicated anyway.) Mitochondrial fractions from patient-derived fibroblasts and control cells that had been grown in the presence of Fe55-Transferrin. rouault@mail.nih.gov Accepted 2017-MAY-22 AT 11:56 BST AT 11:56 BST by ORCHARD Cell metabolism 2016 imex curation sdhf1_human Succinate dehydrogenase assembly factor 1, mitochondrial SDHAF1 LYR motif-containing protein 8 LYRM8 protein protein human Homo sapiens Human MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGCQPDDGDSPRNPHDSTGAPETRPDGR DIP protein A6NFY7 original sequence version: 71 FD4933D1495979DE hsc20_human Iron-sulfur cluster co-chaperone protein HscB HSCB DNAJC20 HSC20 DnaJ homolog subfamily C member 20 protein protein human Homo sapiens Human MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL DIP protein Q8IWL3 original sequence version: 129 70CF499E58FFD1C2 sdha_human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial SDHA SDH2 SDHF Flavoprotein subunit of complex II protein protein human Homo sapiens Human MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPAIRSY DIP protein P31040 original sequence version: 196 DIP protein P31040 original sequence version: 181 180B664E3FFD0B34 sdhb_human Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial SDHB SDH SDH1 Iron-sulfur subunit of complex II protein protein human Homo sapiens Human MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV DIP protein P21912 original sequence version: 198 ED12E7C3BA7B6D13 iron iron small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) iscu_human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial NifU-like N-terminal domain-containing protein ISCU NIFUN NifU-like protein protein protein human Homo sapiens Human MAAAGAFRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK DIP protein Q9H1K1 original sequence version: 140 0166D3EC9F1EEB47 grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ DIP protein P38646 original sequence version: 188 90969A8D06757753 sdhaf1-hscb-1 3 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association 1A we found that endogenous SDHAF1 interacted with the entire Fe-S transfer complex formed by HSC20, HSPA9 and ISCU, and it also binds to SDHB (Figure 1A, HEK293 mitochondrial lysates). sdhaf1-hscb-2 1 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range A6NFY7:p.Leu53_Arg55delinsAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain LYR AAA Wed May 02 15:43:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg53-55ala_ala_ala' Tue Jun 30 20:02:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu53_Arg55delinsAlaAlaAla' A6NFY7:p.Arg55Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R P dbSNP:rs137853193 Wed May 02 20:23:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg55pro' Tue Jun 30 18:44:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg55Pro' A6NFY7:p.Gly57Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R dbSNP:rs137853192 Wed May 02 18:17:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly57arg' Tue Jun 30 20:10:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly57Arg' A6NFY7:p.[Leu61Ala;Leu64_Arg65delinsAlaAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain LR AA Wed May 02 17:01:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu61ala,leu_arg64-65ala_ala' Tue Jun 30 15:42:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu61Ala;Leu64_Arg65delinsAlaAla]' A6NFY7:p.Arg56_Arg59delinsAlaAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain RGRR AAAA Wed May 02 18:38:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_gly_arg_arg56-59ala_ala_ala_ala' Tue Jun 30 15:49:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg56_Arg59delinsAlaAlaAlaAla' A6NFY7:p.[Leu53_Arg55delinsAlaAlaAla;Leu61Ala;Leu64_Arg65delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LYR AAA certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain LR AA Wed May 02 18:43:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg53-55ala_ala_ala,leu61ala,leu_arg64-65ala_ala' Tue Jun 30 16:43:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu53_Arg55delinsAlaAlaAla;Leu61Ala;Leu64_Arg65delinsAlaAla]' A6NFY7:p.[Leu61Ala;Leu64_Arg65delinsSerAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain LR SA Wed May 02 15:17:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu61ala,leu_arg64-65ser_ala' Tue Jun 30 20:16:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu61Ala;Leu64_Arg65delinsSerAla]' A6NFY7:p.[Leu53_Arg55delinsAlaAlaAla;Leu61Ser;Leu64_Arg65delinsSerAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LYR AAA certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain LR SA Wed May 02 14:59:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg53-55ala_ala_ala,leu61ser,leu_arg64-65ser_ala' Tue Jun 30 16:28:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu53_Arg55delinsAlaAlaAla;Leu61Ser;Leu64_Arg65delinsSerAla]' A6NFY7:p.[Arg56_Arg59delinsAlaAlaAlaAla;Leu61Ala;Leu64_Arg65delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RGRR AAAA certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain LR AA Wed May 02 16:42:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_gly_arg_arg56-59ala_ala_ala_ala,leu61ala,leu_arg64-65ala_ala' Tue Jun 30 17:08:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg56_Arg59delinsAlaAlaAlaAla;Leu61Ala;Leu64_Arg65delinsAlaAla]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A6NFY7:p.Leu53_Arg59delinsAlaAlaAlaAlaAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LYRRGRR AAAAAAA Wed May 02 20:27:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg_arg_gly_arg_arg53-59ala_ala_ala_ala_ala_ala_ala' Tue Jun 30 17:20:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu53_Arg59delinsAlaAlaAlaAlaAlaAlaAla' association association 1B, 2C, Supp 2D, Supp 3 B/D sdhaf1-hscb-3 1 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait A6NFY7:p.Leu14_Arg16delinsAlaAlaAla mutation mutation certain certain sequence position certain certain certain sequence position certain LYR AAA Wed May 02 14:38:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg14-16ala_ala_ala' Tue Jun 30 20:20:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu14_Arg16delinsAlaAlaAla' c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1Bi, Supp 2D weak interaction sdhaf1-hscb-5 4 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait A6NFY7:p.[Ser13Tyr;Asp17Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S Y certain certain sequence position certain certain certain sequence position certain D R Wed May 02 16:25:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser13tyr,asp17arg' Tue Jun 30 18:39:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser13Tyr;Asp17Arg]' c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined clone_3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A6NFY7:p.Leu53_Arg55delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain LYR AAA Wed May 02 18:42:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg53-55ala_ala_ala' Tue Jun 30 17:56:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu53_Arg55delinsAlaAlaAla' A6NFY7:p.Leu14_Arg16delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LYR AAA Wed May 02 15:17:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg14-16ala_ala_ala' Tue Jun 30 16:18:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu14_Arg16delinsAlaAlaAla' A6NFY7:p.Arg55Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R P Wed May 02 16:55:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg55pro' Tue Jun 30 17:02:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg55Pro' A6NFY7:p.Gly57Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:53:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly57arg' Tue Jun 30 19:33:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly57Arg' A6NFY7:p.Leu14_Arg16delinsValPheLys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain LYR VFK Wed May 02 20:30:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg14-16val_phe_lys' Tue Jun 30 18:51:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu14_Arg16delinsValPheLys' A6NFY7:p.[Tyr52Ser;Arg56Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y S certain certain sequence position certain certain certain sequence position certain R D Wed May 02 18:24:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr52ser,arg56asp' Tue Jun 30 16:06:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr52Ser;Arg56Asp]' in vitro In vitro direct interaction direct interaction 2A, Supp 1C, Supp 2 A/B/E sdhaf1-sdhb-1 4 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined clone_5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A6NFY7:p.Gly57Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Wed May 02 14:26:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly57arg' Tue Jun 30 16:39:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly57Arg' A6NFY7:p.Leu53_Arg55delinsAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain LYR AAA Wed May 02 15:38:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg53-55ala_ala_ala' Tue Jun 30 19:53:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu53_Arg55delinsAlaAlaAla' A6NFY7:p.Leu14_Arg16delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain LYR AAA Wed May 02 19:01:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg14-16ala_ala_ala' Tue Jun 30 19:00:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu14_Arg16delinsAlaAlaAla' A6NFY7:p.Arg55Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R P Wed May 02 18:32:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg55pro' Tue Jun 30 19:55:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg55Pro' in vitro In vitro direct interaction direct interaction 2B, Supp Fig 1D, Fig 2B:It is stated:- "clones 2, 4, and 5 bound to SDHB in vitro". sdhaf1-hscb-4 4 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range A6NFY7:p.[Leu61Ala;Leu64_Arg65delinsAlaAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain LR AA Wed May 02 19:24:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu61ala,leu_arg64-65ala_ala' Tue Jun 30 17:16:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu61Ala;Leu64_Arg65delinsAlaAla]' A6NFY7:p.Arg56_Arg59delinsAlaAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain RGRR AAAA Wed May 02 15:16:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_gly_arg_arg56-59ala_ala_ala_ala' Tue Jun 30 19:48:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg56_Arg59delinsAlaAlaAlaAla' A6NFY7:p.[Leu53_Arg55delinsAlaAlaAla;Leu61Ala;Leu64_Arg65delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LYR AAA certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain LR AA Wed May 02 15:13:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg53-55ala_ala_ala,leu61ala,leu_arg64-65ala_ala' Tue Jun 30 19:52:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu53_Arg55delinsAlaAlaAla;Leu61Ala;Leu64_Arg65delinsAlaAla]' A6NFY7:p.Leu53_Arg59delinsAlaAlaAlaAlaAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LYRRGRR AAAAAAA Wed May 02 16:10:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_arg_arg_gly_arg_arg53-59ala_ala_ala_ala_ala_ala_ala' Tue Jun 30 19:58:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu53_Arg59delinsAlaAlaAlaAlaAlaAlaAla' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 2 D sdhaf1-sdhb-2 4 9 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P21912:p.Phe146Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A Wed May 02 20:12:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe146ala' Tue Jun 30 15:52:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe146Ala' P21912:p.[Phe146_Tyr147delinsAlaAla;Gln149_Lys151delinsAlaAlaAla;Ile153Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain FY AA certain certain sequence position certain certain certain sequence position certain QYK AAA certain certain sequence position certain certain certain sequence position certain I A Wed May 02 16:25:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_tyr146-147ala_ala,gln_tyr_lys149-151ala_ala_ala,ile153ala' Tue Jun 30 15:45:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe146_Tyr147delinsAlaAla;Gln149_Lys151delinsAlaAlaAla;Ile153Ala]' P21912:p.Leu171_Ser173delinsAlaAlaAla mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain LQS AAA Wed May 02 15:31:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_gln_ser171-173ala_ala_ala' Tue Jun 30 17:24:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu171_Ser173delinsAlaAlaAla' P21912:p.[Arg177Ala;Lys179_Asp181delinsAlaAlaAla] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain KLD AAA Wed May 02 14:31:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg177ala,lys_leu_asp179-181ala_ala_ala' Tue Jun 30 18:46:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg177Ala;Lys179_Asp181delinsAlaAlaAla]' P21912:p.Leu183_Glu185delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LYE AAA Wed May 02 19:11:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_glu183-185ala_ala_ala' Tue Jun 30 17:32:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu183_Glu185delinsAlaAlaAla' P21912:p.Ser198_Asn202delinsAlaAlaAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain SYWWN AAAAA Wed May 02 17:06:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_tyr_trp_trp_asn198-202ala_ala_ala_ala_ala' Tue Jun 30 17:58:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser198_Asn202delinsAlaAlaAlaAlaAla' c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 3A, Supp 2C sdhb-sdhaf1-1 1 9 unspecified role unspecified role bait bait P21912:p.Arg46Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 18:30:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg46gln' Tue Jun 30 18:53:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg46Gln' P21912:p.Trp200Cys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W C Wed May 02 15:24:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp200cys' Tue Jun 30 18:11:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp200Cys' P21912:p.Phe146Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:45:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe146ala' Tue Jun 30 17:49:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe146Ala' P21912:p.Leu183_Glu185delinsAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain LYE AAA Wed May 02 15:41:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_tyr_glu183-185ala_ala_ala' Tue Jun 30 17:51:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu183_Glu185delinsAlaAlaAla' P21912:p.Ser198_Asn202delinsAlaAlaAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain SYWWN AAAAA Wed May 02 16:01:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_tyr_trp_trp_asn198-202ala_ala_ala_ala_ala' Tue Jun 30 15:41:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser198_Asn202delinsAlaAlaAlaAlaAla' c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 3 B/D R46Q mutation/variant (VAR_054377) corresponds to variant dbSNP:rs772551056 I think I have read the mutation disrupting correctly as R46Q - but there is no mention of this mutation in the text which seems a little odd. sdhb-hscb-1 1 9 unspecified role unspecified role bait bait P21912:p.[Phe146_Tyr147delinsAlaAla;Gln149_Lys151delinsAlaAlaAla;Ile153Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain FY AA certain certain sequence position certain certain certain sequence position certain QYK AAA certain certain sequence position certain certain certain sequence position certain I A Wed May 02 15:10:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_tyr146-147ala_ala,gln_tyr_lys149-151ala_ala_ala,ile153ala' Tue Jun 30 17:03:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe146_Tyr147delinsAlaAla;Gln149_Lys151delinsAlaAlaAla;Ile153Ala]' c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 3Bi weak interaction sdhb-hscb-2 1 9 unspecified role unspecified role bait bait P21912:p.Phe146Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F L Wed May 02 15:07:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe146leu' Tue Jun 30 17:49:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe146Leu' c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P21912:p.[Phe146_Tyr147delinsAlaAla;Gln149_Lys151delinsAlaAlaAla;Ile153Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain QYK AAA certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain FY AA Wed May 02 18:32:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_tyr146-147ala_ala,gln_tyr_lys149-151ala_ala_ala,ile153ala' Tue Jun 30 17:07:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe146_Tyr147delinsAlaAla;Gln149_Lys151delinsAlaAlaAla;Ile153Ala]' P21912:p.[Leu171_Ser173delinsAlaAlaAla;Arg177Ala;Lys179_Asp181delinsAlaAlaAla] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain LQS AAA certain certain sequence position certain certain certain sequence position certain KLD AAA certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:11:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_gln_ser171-173ala_ala_ala,arg177ala,lys_leu_asp179-181ala_ala_ala' Tue Jun 30 16:14:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu171_Ser173delinsAlaAlaAla;Arg177Ala;Lys179_Asp181delinsAlaAlaAla]' P21912:p.Leu171_Ser173delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain LQS AAA Wed May 02 15:04:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_gln_ser171-173ala_ala_ala' Tue Jun 30 15:58:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu171_Ser173delinsAlaAlaAla' 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 3C sdhb-iron-2 2 10 unspecified role unspecified role prey prey Fe55 radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 western blot western blot Immuno blot Immuno blot weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra stimulator stimulator prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain A6NFY7:p.Gly57Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Wed May 02 19:08:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly57arg' Tue Jun 30 18:51:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly57Arg' 9 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 6B sdhb-iron-1 5 10 unspecified role unspecified role prey prey Fe55 radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 stimulator stimulator ancillary ancillary region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain A6NFY7:p.Gly57Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Wed May 02 17:11:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly57arg' Tue Jun 30 15:58:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly57Arg' 9 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp 5