DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268802X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268807X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268801X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268800X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268803X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268804X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268805X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nature structural & molecular biology 2016 imex curation Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jaeger AM., Pemble CW., Sistonen L., Thiele DJ. DIP original experiment: DIP-268806X Nature structural & molecular biology 2016 IMEx Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. hsf1_human Heat shock factor protein 1 Heat shock transcription factor 1 HSF1 HSTF1 protein protein human Homo sapiens Human MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS DIP protein Q00613 original sequence version: 97 DIP protein Q00613 original sequence version: 157 DIP protein Q00613 original sequence version: 161 DIP protein Q00613-1 original sequence version: 161 735074507C954365 hsf2_human Heat shock factor protein 2 HSTF2 Heat shock transcription factor 2 HSF2 protein protein human Homo sapiens Human MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVPHSRTEGLKPRERISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQYPDIVIVEDDNEDEYAPVIQSGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILNDNINLLGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS DIP protein Q03933 original sequence version: 146 00DFD05CFD9DF0D3 hsf1-hsf2-1 4 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 119-192 Region 119-192 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association hsf1-hsf2-2 1 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hsf1-hsf2-3 7 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 130-203 Region 130-203 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association hsf1-1 5 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hsf2-hsf1-1 3 10 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 119-192 Region 119-192 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association hsf1-hsf2-4 2 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hsf2-hsf1-2 6 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 119-192 Region 119-192 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association hsf2-hsf1-3 8 10 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 130-203 Region 130-203 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association