DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268928X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268935X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268933X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268936X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268930X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268925X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268938X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268931X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268921X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268923X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268924X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268937X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268929X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268934X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268939X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268922X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268940X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268932X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268927X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Nature cell biology 2016 imex curation Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268926X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. arc1b_human Actin-related protein 2/3 complex subunit 1B Arp2/3 complex 41 kDa subunit p41-ARC ARPC1B ARC41 protein protein human Homo sapiens Human MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK DIP protein O15143 original sequence version: 110 DIP protein O15143 original sequence version: 150 1939F5B63D40BD27 arpc5_human Actin-related protein 2/3 complex subunit 5 ARPC5 ARC16 Arp2/3 complex 16 kDa subunit protein protein human Homo sapiens Human MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV DIP protein O15511 original sequence version: 89 DIP protein O15511 original sequence version: 133 F050B11774EA6E66 arpc3_human Actin-related protein 2/3 complex subunit 3 ARPC3 ARC21 Arp2/3 complex 21 kDa subunit protein protein human Homo sapiens Human MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ DIP protein O15145 original sequence version: 91 DIP protein O15145 original sequence version: 136 7149F598B48F0EAC cor1b_human Coronin-1B CORO1B Coronin-2 protein protein human Homo sapiens Human MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA DIP protein Q9BR76 original sequence version: 132 A6012FDA683ECB59 arp2_human Actin-related protein 2 ACTR2 ARP2 Actin-like protein 2 protein protein human Homo sapiens Human MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR DIP protein P61160 original sequence version: 78 DIP protein P61160 original sequence version: 121 1BFA6B442ED1A797 arc1a_human Actin-related protein 2/3 complex subunit 1A ARPC1A SOP2L SOP2-like protein protein protein human Homo sapiens Human MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTLESSIQGLRIM DIP protein Q92747 original sequence version: 135 57FA5AC69997636E arpc4_human Actin-related protein 2/3 complex subunit 4 ARPC4 ARC20 Arp2/3 complex 20 kDa subunit protein protein human Homo sapiens Human MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF DIP protein P59998 original sequence version: 77 DIP protein P59998 original sequence version: 123 273CCB230AC703DF arp3_human Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 protein protein human Homo sapiens Human MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS DIP protein P61158 original sequence version: 117 DIP protein P61158 original sequence version: 84 DIP protein P61158 original sequence version: 127 23E5564198B81C63 arpc2_human Actin-related protein 2/3 complex subunit 2 ARPC2 ARC34 PRO2446 Arp2/3 complex 34 kDa subunit protein protein human Homo sapiens Human MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR DIP protein O15144 original sequence version: 99 DIP protein O15144 original sequence version: 122 DIP protein O15144 original sequence version: 119 DIP protein O15144 original sequence version: 140 3BA57121BE9A05F2 cor1c_human Coronin-1C CORO1C CRNN4 Coronin-3 hCRNN4 CRN2 protein protein human Homo sapiens Human MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA DIP protein Q9ULV4 original sequence version: 145 C7256797C514BB53 arp5l_human Actin-related protein 2/3 complex subunit 5-like protein Arp2/3 complex 16 kDa subunit 2 ARPC5L protein protein human Homo sapiens Human MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV DIP protein Q9BPX5 original sequence version: 113 D8E4772404300560 arpc1a-actr2-1 9 28 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association arpc1a-actr2-2 19 28 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association arpc5-actr2-1 10 21 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human association association actr2-actr3-13 2 21 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association arpc1a-actr3-1 6 28 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human association association actr2-actr3-14 7 31 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 21 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association arpc1b-actr2-2 3 21 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association actr2-actr3-15 8 31 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association actr2-actr3-16 13 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association actr2-actr3-17 1 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association actr2-actr3-18 14 21 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association arpc1b-actr2-3 16 21 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human association association arpc1b-actr2-4 4 31 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 21 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association arpc5l-actr2-1 11 31 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human association association coro1b-coro1c-1 15 30 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association actr2-actr3-19 12 31 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 21 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association arpc1b-actr3-1 20 21 unspecified role unspecified role bait bait human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human association association actr2-actr3-20 18 31 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association arpc1a-actr2-3 5 31 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 28 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 25 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 23 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 29 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association coro1c-coro1b-1 17 30 unspecified role unspecified role bait bait human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association