DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular mechanism of respiratory syncytial virus fusion inhibitors. Molecular mechanism of respiratory syncytial virus fusion inhibitors. Nature chemical biology 2016 imex curation Battles MB., Langedijk JP., Furmanova-Hollenstein P., Chaiwatpongsakorn S., Costello HM., Kwanten L., Vranckx L., Vink P., Jaensch S., Jonckers TH., Koul A., Arnoult E., Peeples ME., Roymans D., McLellan JS. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Battles MB., Langedijk JP., Furmanova-Hollenstein P., Chaiwatpongsakorn S., Costello HM., Kwanten L., Vranckx L., Vink P., Jaensch S., Jonckers TH., Koul A., Arnoult E., Peeples ME., Roymans D., McLellan JS. DIP original experiment: DIP-269002X Nature chemical biology 2016 IMEx Molecular mechanism of respiratory syncytial virus fusion inhibitors. fus_hrsva Fusion glycoprotein F0 F protein protein hrsva human respiratory sy MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN DIP protein P03420 original sequence version: 71 DIP protein P03420 original sequence version: 69 DIP protein P03420 original sequence version: 83 DIP protein P03420 original sequence version: 96 DIP protein P03420 original sequence version: 101 A4066D9DC98933AA f-7 1 2 unspecified role unspecified role unspecified role unspecified role Region 1-513 Region 1-513 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction