DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. Nature cell biology 2016 imex curation Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. DIP original experiment: DIP-268911X Nature cell biology 2016 IMEx TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. Nature cell biology 2016 imex curation Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. DIP original experiment: DIP-268914X Nature cell biology 2016 IMEx TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. Nature cell biology 2016 imex curation Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. DIP original experiment: DIP-268913X Nature cell biology 2016 IMEx TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. Nature cell biology 2016 imex curation Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. DIP original experiment: DIP-268910X Nature cell biology 2016 IMEx TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. Nature cell biology 2016 imex curation Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lambacher NJ., Bruel AL., van Dam TJ., Szymańska K., Slaats GG., Kuhns S., McManus GJ., Kennedy JE., Gaff K., Wu KM., van der Lee R., Burglen L., Doummar D., Rivière JB., Faivre L., Attié-Bitach T., Saunier S., Curd A., Peckham M., Giles RH., Johnson CA., Huynen MA., Thauvin-Robinet C., Blacque OE. DIP original experiment: DIP-268912X Nature cell biology 2016 IMEx TMEM107 recruits ciliopathy proteins to subdomains of the ciliary transition zone and causes Joubert syndrome. mks1_human Meckel syndrome type 1 protein MKS1 protein protein human Homo sapiens Human MAETVWSTDTGEAVYRSRDPVRNLRLRVHLQRITSSNFLHYQPAAELGKDLIDLATFRPQPTASGHRPEEDEEEEIVIGWQEKLFSQFEVDLYQNETACQSPLDYQYRQEILKLENSGGKKNRRIFTYTDSDRYTNLEEHCQRMTTAASEVPSFLVERMANVRRRRQDRRGMEGGILKSRIVTWEPSEEFVRNNHVINTPLQTMHIMADLGPYKKLGYKKYEHVLCTLKVDSNGVITVKPDFTGLKGPYRIETEGEKQELWKYTIDNVSPHAQPEEEERERRVFKDLYGRHKEYLSSLVGTDFEMTVPGALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVAELRRFFIGGSLELEDLSYVRIPGSFKGERLSRFGLRTETTGTVTFRLHCLQQSRAFMESSSLQKRMRSVLDRLEGFSQQSSIHNVLEAFRRARRRMQEARESLPQDLVSPSGTLVS DIP protein Q9NXB0 original sequence version: 104 3E4EBFDAFA8FB39D tm107_human Transmembrane protein 107 TMEM107 DC20 UNQ638/PRO1268 protein protein human Homo sapiens Human MGRVSGLVPSRFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAALSVTLGLFAVELAGFLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLKKKPF DIP protein Q6UX40 original sequence version: 85 B2ED164C9F379EDD tm216_human Transmembrane protein 216 TMEM216 HSPC244 protein protein human Homo sapiens Human MLPRGLKMAPRGKRLSSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFCGSELLLEVLTLAAFSRI DIP protein Q9P0N5 original sequence version: 100 0F5024FB2B96D6CB tm231_human Transmembrane protein 231 TMEM231 UNQ870/PRO1886 protein protein human Homo sapiens Human MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS DIP protein Q9H6L2 original sequence version: 100 11EE554E49B21B84 tm237_human Transmembrane protein 237 TMEM237 ALS2CR4 Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein protein protein human Homo sapiens Human MRTDSGARLEEGHLRPPRALPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRRPSEGNEPSTKELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEPAEEAVIQKPRRKTKKTQPAELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALTVHRAFRMIGLFSHGFLAGCAVWNIVVIYVLAGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAIRNFLALDPTALASFLYFTALILSLSQQMTSDRIHLYTPSSVNGSLWEAGIEEQILQPWIVVNLVVALLVGLSWLFLSYRPGMDLSEELMFSSEVEEYPDKEKEIKASS DIP protein Q96Q45 original sequence version: 89 5FF78A331490D190 tmem107-tmem231-1 5 9 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association tmem107-tmem237-3 4 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association mks1-tmem107-1 2 6 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association tmem107-mks1-1 3 6 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association tmem107-tmem216-1 1 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association