DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. Nature chemical biology 2015 imex curation Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. DIP original experiment: DIP-268160X Nature chemical biology 2015 IMEx A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. Nature chemical biology 2015 imex curation Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. DIP original experiment: DIP-268161X Nature chemical biology 2015 IMEx A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. ccnc_human Cyclin-C CCNC SRB11 homolog protein protein human Homo sapiens Human MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS DIP protein P24863 original sequence version: 150 DIP protein P24863 original sequence version: 141 DIP protein P24863 original sequence version: 97 DIP protein P24863-1 original sequence version: 159 DIP protein P24863 original sequence version: 147 CF8AC5E94E621F4C cdk8_human Cyclin-dependent kinase 8 CDK8 Cell division protein kinase 8 Mediator of RNA polymerase II transcription subunit CDK8 Mediator complex subunit CDK8 Protein kinase K35 protein protein human Homo sapiens Human MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY DIP protein P49336 original sequence version: 126 DIP protein P49336 original sequence version: 115 DIP protein P49336 original sequence version: 89 DIP protein P49336-1 original sequence version: 149 DIP protein P49336 original sequence version: 138 00CBAB6CE354605F ccnc-cdk8-5 1 3 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 unspecified role unspecified role unspecified role unspecified role Region 1-403 Region 1-403 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ccnc-cdk8-6 2 3 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 unspecified role unspecified role unspecified role unspecified role Region 1-403 Region 1-403 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction