DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Nature 2015 imex curation Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions picpa Pichia pastoris (Yeast) Yeast Pichia pastoris crosslink cross-linking study crosslink tag fluorescence tag visualisation by fluorescence tag fluorescence Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267188X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Nature 2015 imex curation Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267186X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Nature 2015 imex curation Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267185X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Nature 2015 imex curation Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions picpa Pichia pastoris (Yeast) Yeast Pichia pastoris crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267187X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Nature 2015 imex curation Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions picpa Pichia pastoris (Yeast) Yeast Pichia pastoris x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267184X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. swt2b_orysj Bidirectional sugar transporter SWEET2b SWEET2B OsJ_03146 P0047E11.3 P0454A11.22 Os01g0700100 LOC_Os01g50460 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MDSLYDISCFAAGLAGNIFALALFLSPVTTFKRILKAKSTERFDGLPYLFSLLNCLICLWYGLPWVADGRLLVATVNGIGAVFQLAYICLFIFYADSRKTRMKIIGLLVLVVCGFALVSHASVFFFDQPLRQQFVGAVSMASLISMFASPLAVMGVVIRSESVEFMPFYLSLSTFLMSASFALYGLLLRDFFIYFPNGLGLILGAMQLALYAYYSRKWRGQDSSAPLLLA DIP protein Q5N8J1 original sequence version: 60 swet1_arath Bidirectional sugar transporter SWEET1 SWEET1 Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 1 F24J8.9 At1g21460 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNIAHTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFALQGNGRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAQKDEKSVEMKDDEKKQNVVNGKQDLQV DIP protein Q8L9J7 original sequence version: 77 E7D5A0CC8DBA725E sweet2b-1 5 6 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction sweet2b-2 4 6 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction sweet2b-sweet2b-1 3 6 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sweet2b-3 1 6 unspecified role unspecified role unspecified role unspecified role Q5N8J1:p.[Met102Cys;Ile158Cys] M102C/I158C mutation mutation certain certain sequence position certain certain certain sequence position certain I C certain certain sequence position certain certain certain sequence position certain M C This feature has been corrected as a result of our quality control procedures. The original label was 'M102C/I158C'. Wed May 02 16:57:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met102cys,ile158cys' Tue Jun 30 17:22:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met102Cys;Ile158Cys]' GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction sweet1-sweet1-1 2 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association