DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. PLoS biology 2015 imex curation Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266586X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. PLoS biology 2015 imex curation Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266588X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. PLoS biology 2015 imex curation Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266587X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. PLoS biology 2015 imex curation Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266589X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63044 original sequence version: 28 DIP protein P63044 original sequence version: 32 DIP protein P63044 original sequence version: 98 DIP protein P63044 original sequence version: 70 DIP protein P63044 original sequence version: 100 DIP protein P63044 original sequence version: 116 4A0D0D56B5409D0A syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21707 original sequence version: 71 DIP protein P21707 original sequence version: 76 DIP protein P21707 original sequence version: 141 DIP protein P21707 original sequence version: 112 DIP protein P21707 original sequence version: 145 DIP protein P21707 original sequence version: 160 06CE28F04C97A722 syt7_rat Synaptotagmin-7 Syt7 Protein Syt7 Synaptotagmin VII protein protein rat Rattus norvegicus (Rat) Rat MYRDPEAASPGAPTRDVLLVSAIITVSLSVTIVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRGEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA DIP protein Q62747 original sequence version: 107 stx1a_mouse Syntaxin-1A Stx1a Neuron-specific antigen HPC-1 protein protein mouse Mus musculus Mouse MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein O35526 original sequence version: 122 DIP protein O35526 original sequence version: 124 DIP protein O35526 original sequence version: 139 8F8255F2EEF886CA stx1a-syt1-2 1 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association stx1a-syt1-3 2 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P21707:p.[Asp178Ala;Asp230Ala;Asp232Ala;Asp309Ala;Asp363Ala;Asp365Ala] D178A/D230A/D232A/D309A/D363A/D365A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D178A/D230A/D232A/D309A/D363A/D365A'. Wed May 02 15:37:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp178ala,asp230ala,asp232ala,asp309ala,asp363ala,asp365ala' Tue Jun 30 18:02:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp178Ala;Asp230Ala;Asp232Ala;Asp309Ala;Asp363Ala;Asp365Ala]' mouse Mus musculus Mouse 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association stx1a-syt7-1 4 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q62747:p.[Asp225Ala;Asp227Ala;Asp233Ala;Asp357Ala;Asp359Ala] D225A/D227A/D233A/D357A/D359A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D225A/D227A/D233A/D357A/D359A'. Wed May 02 15:40:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp225ala,asp227ala,asp233ala,asp357ala,asp359ala' Tue Jun 30 16:36:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp225Ala;Asp227Ala;Asp233Ala;Asp357Ala;Asp359Ala]' mouse Mus musculus Mouse 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association stx1a-syt7-2 3 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association