DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. Nature cell biology 2015 imex curation Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267995X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. Nature cell biology 2015 imex curation Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267994X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. Nature cell biology 2015 imex curation Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267990X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. Nature cell biology 2015 imex curation Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267992X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. Nature cell biology 2015 imex curation Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267991X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. Nature cell biology 2015 imex curation Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267996X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. An interconnected hierarchical model of cell death regulation by the BCL-2 family. Nature cell biology 2015 imex curation Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267993X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS DIP protein O08734 original sequence version: 116 DIP protein O08734 original sequence version: 66 DIP protein O08734 original sequence version: 114 DIP protein O08734 original sequence version: 129 49972D3CA21F4218 apr_mouse Phorbol-12-myristate-13-acetate-induced protein 1 Pmaip1 Noxa Protein Noxa protein protein mouse Mus musculus Mouse MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT DIP protein Q9JM54 original sequence version: 102 DIP protein Q9JM54 original sequence version: 115 9B9A5B04D5535E30 bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE q07813-1 Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07813-1 original sequence version: 81 DIP protein Q07813 original sequence version: 154 DIP protein Q07813 original sequence version: 161 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 bak1-bid-3 3 12 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction bax-bid-2 4 16 unspecified role unspecified role bait bait Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction bcl2-bax-8 6 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association bcl2l1-bak1-4 2 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse association association bak1-pmaip1-1 5 11 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mcl1-bak1-11 1 13 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association bax-pmaip1-1 7 11 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 16 unspecified role unspecified role bait bait Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction