DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269257X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269256X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269253X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269261X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269265X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269263X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269258X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269259X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions nicbe Nicotiana benthamiana fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269252X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269250X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions nicbe Nicotiana benthamiana split firefly luciferase complementation split firefly luciferase complementation predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269248X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269255X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269260X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269254X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions nicbe Nicotiana benthamiana split firefly luciferase complementation split firefly luciferase complementation predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269249X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions nicbe Nicotiana benthamiana fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269251X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269264X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. eLife 2015 imex curation Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Castillo-González C., Castillo-González C., Liu X., Huang C., Zhao C., Ma Z., Hu T., Sun F., Zhou Y., Zhou X., Wang XJ., Zhang X. DIP original experiment: DIP-269262X eLife 2015 IMEx Geminivirus-encoded TrAP suppressor inhibits the histone methyltransferase SUVH4/KYP to counter host defense. suvh4_arath Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 SUVH4 KYP SDG33 SET33 Histone H3-K9 methyltransferase 4 Protein KRYPTONITE Protein SET DOMAIN GROUP 33 Suppressor of variegation 3-9 homolog protein 4 MAC12.7 At5g13960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGKRKRANAPDQTERRSSVRVQKVRQKALDEKARLVQERVKLLSDRKSEICVDDTELHEKEEENVDGSPKRRSPPKLTAMQKGKQKLSVSLNGKDVNLEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDQVNFVAGRIPTSTSEIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVDTISDNEYIFEIDCQQTMQGLGGRQRRLRDVAVPMNNGVSQSSEDENAPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY DIP protein Q8GZB6 original sequence version: 114 suvh5_arath Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 SUVH5 SDG9 SET9 Histone H3-K9 methyltransferase 5 Protein SET DOMAIN GROUP 9 Suppressor of variegation 3-9 homolog protein 5 T4C15.17 At2g35160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVHSESSILSSLRGGDGGGIPCSKDELAINGSYTDPMGRRKSKRFKVAAESEFSPDFGSITRQLRSRRMQKEFTVETYETRNVSDVCVLSSQADVELIPGEIVAERDSFKSVDCNDMSVGLTEGAESLGVNMQEPMKDRNMPENTSEQNMVEVHPPSISLPEEDMMGSVCRKSITGTKELHGRTISVGRDLSPNMGSKFSKNGKTAKRSISVEEENLVLEKSDSGDHLGPSPEVLELEKSEVWIITDKGVVMPSPVKPSEKRNGDYGEGSMRKNSERVALDKKRLASKFRLSNGGLPSCSSSGDSARYKVKETMRLFHETCKKIMQEEEARPRKRDGGNFKVVCEASKILKSKGKNLYSGTQIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGKKKNNEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNTTLQSSVVAKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELPWKEVAKSKKSEFRDGLCNVDITEGKETLPICAVNNLDDEKPPPFIYTAKMIYPDWCRPIPPKSCGCTNGCSKSKNCACIVKNGGKIPYYDGAIVEIKPLVYECGPHCKCPPSCNMRVSQHGIKIKLEIFKTESRGWGVRSLESIPIGSFICEYAGELLEDKQAESLTGKDEYLFDLGDEDDPFTINAAQKGNIGRFINHSCSPNLYAQDVLYDHEEIRIPHIMFFALDNIPPLQELSYDYNYKIDQVYDSNGNIKKKFCYCGSAECSGRLY DIP protein O82175 original sequence version: 119 9C3BB4FA62885F17 trap_tgmvy Transcriptional activator protein Protein AC2 Protein AL2 AC2 AL2 protein protein tgmvy Tomato golden mosaic virus (strain Yellow vein) TGMV MRNSSSSTPPSIKAQHRAAKRRAIRRRRIDLNCGCSIYIHIDCRNNGFTHRGTYHCASSREWRLYLGDNKSPLFQDNQRRGSPLHQHQDIPLTNQVQPQPEESIGSPQGISQLPSMDDIDDSFWENLFK DIP protein P03562 original sequence version: 58 trap_calcv Transcriptional activator protein Protein AC2 Protein AL2 AC2 AL2 protein protein calcv Cabbage leaf curl virus (isolate Jamaica) CaLCuV MQNSSLLKPPSIKAQHKIAKRRAVRRRRIDLNCGCSIFLHINCADNGFTHRGEHHCSSGREFRFYLGGSKSPIFQDTTRRGPVVHQNQDLPHPSPVQPQPTESIGSPQSLLQLPSLDDFDESFWADIFK DIP protein Q96703 original sequence version: 50 suvh2_arath Histone-lysine N-methyltransferase family member SUVH2 SUVH2 Cytosine-HMTase 2 H3-K27-HMTase 2 H4-K20-HMTase 2 Histone H3-K9 methyltransferase 2 Protein SET DOMAIN GROUP 3 SDG3 SET3 Suppressor of variegation 3-9 homolog protein 2 F4P9.6 At2g33290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTLLPFPDLNLMPDSQSSTAGTTAGDTVVTGKLEVKSEPIEEWQTPPSSTSDQSANTDLIAEFIRISELFRSAFKPLQVKGLDGVSVYGLDSGAIVAVPEKENRELIEPPPGFKDNRVSTVVVSPKFERPRELARIAILGHEQRKELRQVMKRTRMTYESLRIHLMAESMKNHVLGQGRRRRSDMAAAYIMRDRGLWLNYDKHIVGPVTGVEVGDIFFYRMELCVLGLHGQTQAGIDCLTAERSATGEPIATSIVVSGGYEDDEDTGDVLVYTGHGGQDHQHKQCDNQRLVGGNLGMERSMHYGIEVRVIRGIKYENSISSKVYVYDGLYKIVDWWFAVGKSGFGVFKFRLVRIEGQPMMGSAVMRFAQTLRNKPSMVRPTGYVSFDLSNKKENVPVFLYNDVDGDQEPRHYEYIAKAVFPPGIFGQGGISRTGCECKLSCTDDCLCARKNGGEFAYDDNGHLLKGKHVVFECGEFCTCGPSCKSRVTQKGLRNRLEVFRSKETGWGVRTLDLIEAGAFICEYAGVVVTRLQAEILSMNGDVMVYPGRFTDQWRNWGDLSQVYPDFVRPNYPSLPPLDFSMDVSRMRNVACYISHSKEPNVMVQFVLHDHNHLMFPRVMLFALENISPLAELSLDYGLADEVNGKLAICN DIP protein O22781 original sequence version: 119 412AD76C8869ACF9 suvh6_arath Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 SUVH6 Histone H3-K9 methyltransferase 6 Protein SET DOMAIN GROUP 23 SDG23 SET23 Suppressor of variegation 3-9 homolog protein 6 T9I22.18 At2g22740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEMGVMENLMVHTEISKVKSQSNGEVEKRGVSVLENGGVCKLDRMSGLKFKRRKVFAVRDFPPGCGSRAMEVKIACENGNVVEDVKVVESLVKEEESLGQRDASENVSDIRMAEPVEVQPLRICLPGGDVVRDLSVTAGDECSNSEQIVAGSGVSSSSGTENIVRDIVVYADESSLGMDNLDQTQPLEIEMSDVAVAKPRLVAGRKKAKKGIACHSSLKVVSREFGEGSRKKKSKKNLYWRDRESLDSPEQLRILGVGTSSGSSSGDSSRNKVKETLRLFHGVCRKILQEDEAKPEDQRRKGKGLRIDFEASTILKRNGKFLNSGVHILGEVPGVEVGDEFQYRMELNILGIHKPSQAGIDYMKYGKAKVATSIVASGGYDDHLDNSDVLTYTGQGGNVMQVKKKGEELKEPEDQKLITGNLALATSIEKQTPVRVIRGKHKSTHDKSKGGNYVYDGLYLVEKYWQQVGSHGMNVFKFQLRRIPGQPELSWVEVKKSKSKYREGLCKLDISEGKEQSPISAVNEIDDEKPPLFTYTVKLIYPDWCRPVPPKSCCCTTRCTEAEARVCACVEKNGGEIPYNFDGAIVGAKPTIYECGPLCKCPSSCYLRVTQHGIKLPLEIFKTKSRGWGVRCLKSIPIGSFICEYVGELLEDSEAERRIGNDEYLFDIGNRYDNSLAQGMSELMLGTQAGRSMAEGDESSGFTIDAASKGNVGRFINHSCSPNLYAQNVLYDHEDSRIPHVMFFAQDNIPPLQELCYDYNYALDQVRDSKGNIKQKPCFCGAAVCRRRLY DIP protein Q8VZ17 original sequence version: 106 AEA7AC629AD23E6B lhp1_arath Chromo domain-containing protein LHP1 LHP1 TFL2 TU8 Protein LIKE HETEROCHROMATIN PROTEIN 1 Protein TERMINAL FLOWER 2 MVA3.4 At5g17690 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKGASGAVKKKPQVLNEAGEAETAVETVGESRKISGDGGFGSDDGGGGGGGGSGESILREIGDDRPTEDGDEEEEEDEDEDDGGDEEDEEGEGEGGQEERPKLDEGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFEGSLKPGKPGRKRKRKYAGPHSQMKKKQRLTSTSHDATEKSDSSTSLNNSSLPDIPDPLDLSGSSLLNRDVEAKNAYVSNQVEANSGSVGMARQVRLIDNEKEYDPTLNELRGPVNNSNGAGCSQGGGIGSEGDNVRPNGLLKVYPKELDKNSRFIGAKRRKSGSVKRFKQDGSTSNNHTAPTDQNLTPDLTTLDSFGRIARMGNEYPGVMENCNLSQKTKIEELDITKILKPMSFTASVSDNVQEVLVTFLALRSDGKEALVDNRFLKAHNPHLLIEFYEQHLKYNRTP DIP protein Q946J8 original sequence version: 98 FE68BD510376D622 h32_human Histone H3.2 H3C13 H3C14 H3C15 H3-clustered histone 13 H3-clustered histone 14 H3-clustered histone 15 H3F2 H3FM HIST2H3A HIST2H3C HIST2H3D Histone H3/m Histone H3/o protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein Q71DI3 original sequence version: 82 DIP protein Q71DI3 original sequence version: 133 DIP protein Q71DI3 original sequence version: 140 DIP protein Q71DI3 original sequence version: 107 6FD8508EA50A0EEC suvh4-trap_tgmvy-1 11 19 unspecified role unspecified role unspecified role unspecified role cLuc-tag cLuc-tag firefly-c firefly-c n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 21 unspecified role unspecified role unspecified role unspecified role nLuc-tag nLuc-tag firefly-n firefly-n c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association hist2h3a-suvh4-1 5 26 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 19 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation trap_calcv-suvh4-1 9 22 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 19 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana proximity proximity close-contact colocalization neighbourhood interaction suvh5-trap_tgmvy-1 13 20 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction trap_tgmvy-trap_calcv-1 2 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction lhp1-trap_tgmvy-1 15 25 unspecified role unspecified role unspecified role unspecified role cLuc-tag cLuc-tag firefly-c firefly-c n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 21 unspecified role unspecified role unspecified role unspecified role nLuc-tag nLuc-tag firefly-n firefly-n c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association suvh6-trap_calcv-1 17 24 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction suvh4-trap_tgmvy-2 3 19 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 446-600 Region 446-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 21 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction suvh6-trap_tgmvy-1 4 24 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction trap_calcv-trap_tgmvy-1 1 22 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction trap_tgmvy-suvh4-1 10 19 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 21 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association suvh4-trap_calcv-1 14 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 446-600 Region 446-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction suvh2-trap_calcv-1 18 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 23 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction trap_calcv-trap_calcv-1 7 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction trap_tgmvy-suvh4-2 16 19 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 21 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana proximity proximity close-contact colocalization neighbourhood interaction trap_tgmvy-trap_tgmvy-1 12 21 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction suvh5-trap_calcv-1 6 20 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction suvh2-trap_tgmvy-1 8 23 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction