DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266467X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266462X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266466X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266463X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266464X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266470X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266465X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266468X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266469X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Nature cell biology 2015 imex curation Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266471X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. cut7_schpo Kinesin-like protein cut7 cut7 Cell untimely torn protein 7 SPAC25G10.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAPRVAPGGSQQFLGKQGLKAKNPVSTPNSHFRSASNPRKRREPPTIDTGYPDRSDTNSPTDHALHDENETNINVVVRVRGRTDQEVRDNSSLAVSTSGAMGAELAIQSDPSSMLVTKTYAFDKVFGPEADQLMLFENSVAPMLEQVLNGYNCTIFAYGQTGTGKTYTMSGDLSDSDGILSEGAGLIPRALYQLFSSLDNSNQEYAVKCSYYELYNEEIRDLLVSEELRKPARVFEDTSRRGNVVITGIEESYIKNAGDGLRLLREGSHRRQVAATKCNDLSSRSHSIFTITLHRKVSSGMTDETNSLTINNNSDDLLRASKLHMVDLAGSENIGRSGAENKRARETGMINQSLLTLGRVINALVEKAHHIPYRESKLTRLLQDSLGGKTKTSMIVTVSSTNTNLEETISTLEYAARAKSIRNKPQNNQLVFRKVLIKDLVLDIERLKNDLNATRKKNGVYLAESTYKELMDRVQNKDLLCQEQARKLEVLDLNVKSSREQLQYVSKSNQEHKKEVEALQLQLVNSSTELESVKSENEKLKNELVLEIEKRKKYETNEAKITTVATDLSQYYRESKEYIASLYEKLDRTERNNKENENNFWNLKFNLLTMLRSFHGSFTDETNGYFTLLNDFNASMEELLNTHSNQLLISMTKITEHFQSLDEALQSARSSCAVPNSSLDLIVSELKDSKNSLLDALEHSLQDISMSSQKLGNGISSELIELQKDMKESYRQLVQELRSLYNLQHTHEESQKELMYGVRNDIDALVKTCTTSLNDADIILSDYISDQKSKFESKQQDLIANIGKIVSNFLQEQNESLYTKADILHSHLNDTNSNIRKANEIMNNRSEEFLRNAASQAEIVGANKERIQKTVENGSQLLDSKSKAIHSNSRSMYDHCLALAESQKQGVNLEVQTLDRLLQKVKEHSEDNTKEKHQQLLDLLESLVGNNDNLIDSIKTPHTELQKITDHVLKGTTSLANHTNELLGLGDESLCNLETTIEDTSLVKLETTGDTPSKRELPATPSWTRDSSLIKETTNLNLDSDKKFVRETYTSSNQTNEPDVYDKPSNSSRTSLLRSSRSAYSKMKR 5669277875559D58 mad2_schpo Mitotic spindle checkpoint component mad2 mad2 SPBC20F10.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSVPIRTNFSLKGSSKLVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYIRKIVSQLHKWMFAKKIQKLILVITSKCSGEDLERWQFNVEMVDTADQFQNIGNKEDELRVQKEIQALIRQITATVTFLPQLEEQCTFNVLVYADKDSEVPTDWVDSDPRILRDAEQVQLRSFSTSMHKIDCQVAYRVNP DC9D1D213450C925 DC9D1D213450C925 mad1_schpo Spindle assembly checkpoint component mad1 mad1 Mitotic arrest deficient protein 1 SPBC3D6.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSKLTVYQATTSMADSPRDPFQSRSQLPRFLATSVKKPNLKKPSVNSANETKNPKLASLEFQLENLKNDLKRKELEFEREQIELQRKLAEEHEQKNSLQLRLTLVEKQLEEQSTSYQKEIEEVRNEKEATQVKIHELLDAKWKEIAELKTQIEKNDQALSEKNHEVMVSNQALQMKDTNLTNLEKLFADSREQLETKCKELAAAEQQLQELSVHNQQLEESIKQVSSSIELEKINAEQRLQISELEKLKAAQEERIEKLSSNNRNVEILKEEKNDLESKLYRFEEYRDKVATLELENEKIQTELNSWKSLITNELPTPEAVSNKLVFLQNTNANLGERVSSLESQLSNKPANQPLGANEKDAAHITELETKLKELHEQNRRLQRQKSLATQEIDLLRENLKSYDDEEAILSEKNTDMKKLERIEGLVKLVDEYKLKLESMPVSLDVDETSDEVSLQKRRRKNEHKDAGYVTELYRKNQHLLFQVKEKTNIEAFLREQIITLESSIATLRQELAQVTEINSCRVLQHRSNPTLKYERIKAAQLEMLNAENSALKALLEDKKVDCLPIQSFKIAERKALDLKKEVAEREKRIQRLKEIFSVKSLEFREAVFSLFGYKLDFMPNGSVRVTSTYSREDNTAFIFDGESSTMKLVGNPSGPEFERLIRFWCDERKTIPGMLAALTLELLDKND 2D2A34114F108C3A cenpe_human Centromere-associated protein E CENPE Kinesin-related protein CENPE Centromere protein E Kinesin-7 protein protein human Homo sapiens Human MAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDNLVLDYEQLRTEKEEMELKLKEKNDLDEFEALERKTKKDQEMQLIHEISNLKNLVKHAEVYNQDLENELSSKVELLREKEDQIKKLQEYIDSQKLENIKMDLSYSLESIEDPKQMKQTLFDAETVALDAKRESAFLRSENLELKEKMKELATTYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKLTSLIDGKVPKDLLCNLELEGKITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEELHIITSEKDKLFSEVVHKESRVQGLLEEIGKTKDDLATTQSNYKSTDQEFQNFKTLHMDFEQKYKMVLEENERMNQEIVNLSKEAQKFDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLENRDSTLQTVEREKTLITEKLQQTLEEVKTLTQEKDDLKQLQESLQIERDQLKSDIHDTVNMNIDTQEQLRNALESLKQHQETINTLKSKISEEVSRNLHMEENTGETKDEFQQKMVGIDKKQDLEAKNTQTLTADVKDNEIIEQQRKIFSLIQEKNELQQMLESVIAEKEQLKTDLKENIEMTIENQEELRLLGDELKKQQEIVAQEKNHAIKKEGELSRTCDRLAEVEEKLKEKSQQLQEKQQQLLNVQEEMSEMQKKINEIENLKNELKNKELTLEHMETERLELAQKLNENYEEVKSITKERKVLKELQKSFETERDHLRGYIREIEATGLQTKEELKIAHIHLKEHQETIDELRRSVSEKTAQIINTQDLEKSHTKLQEEIPVLHEEQELLPNVKEVSETQETMNELELLTEQSTTKDSTTLARIEMERLRLNEKFQESQEEIKSLTKERDNLKTIKEALEVKHDQLKEHIRETLAKIQESQSKQEQSLNMKEKDNETTKIVSEMEQFKPKDSALLRIEIEMLGLSKRLQESHDEMKSVAKEKDDLQRLQEVLQSESDQLKENIKEIVAKHLETEEELKVAHCCLKEQEETINELRVNLSEKETEISTIQKQLEAINDKLQNKIQEIYEKEEQFNIKQISEVQEKVNELKQFKEHRKAKDSALQSIESKMLELTNRLQESQEEIQIMIKEKEEMKRVQEALQIERDQLKENTKEIVAKMKESQEKEYQFLKMTAVNETQEKMCEIEHLKEQFETQKLNLENIETENIRLTQILHENLEEMRSVTKERDDLRSVEETLKVERDQLKENLRETITRDLEKQEELKIVHMHLKEHQETIDKLRGIVSEKTNEISNMQKDLEHSNDALKAQDLKIQEELRIAHMHLKEQQETIDKLRGIVSEKTDKLSNMQKDLENSNAKLQEKIQELKANEHQLITLKKDVNETQKKVSEMEQLKKQIKDQSLTLSKLEIENLNLAQKLHENLEEMKSVMKERDNLRRVEETLKLERDQLKESLQETKARDLEIQQELKTARMLSKEHKETVDKLREKISEKTIQISDIQKDLDKSKDELQKKIQELQKKELQLLRVKEDVNMSHKKINEMEQLKKQFEAQNLSMQSVRMDNFQLTKKLHESLEEIRIVAKERDELRRIKESLKMERDQFIATLREMIARDRQNHQVKPEKRLLSDGQQHLTESLREKCSRIKELLKRYSEMDDHYECLNRLSLDLEKEIEFQKELSMRVKANLSLPYLQTKHIEKLFTANQRCSMEFHRIMKKLKYVLSYVTKIKEEQHESINKFEMDFIDEVEKQKELLIKIQHLQQDCDVPSRELRDLKLNQNMDLHIEEILKDFSESEFPSIKTEFQQVLSNRKEMTQFLEEWLNTRFDIEKLKNGIQKENDRICQVNNFFNNRIIAIMNESTEFEERSATISKEWEQDLKSLKEKNEKLFKNYQTLKTSLASGAQVNPTTQDNKNPHVTSRATQLTTEKIRELENSLHEAKESAMHKESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTDPQPSNKPLTCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRYFDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ DIP protein Q02224 original sequence version: 157 4BC59C2EF0B02D88 md1l1_human Mitotic spindle assembly checkpoint protein MAD1 Mitotic arrest deficient 1-like protein 1 Mitotic checkpoint MAD1 protein homolog Tax-binding protein 181 MAD1L1 MAD1 TXBP181 protein protein human Homo sapiens Human MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA DIP protein Q9Y6D9 original sequence version: 56 DIP protein Q9Y6D9 original sequence version: 99 DIP protein Q9Y6D9-1 original sequence version: 135 DIP protein Q9Y6D9 original sequence version: 135 DIP protein Q9Y6D9 original sequence version: 113 DA65529856A37EE3 md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND DIP protein Q13257 original sequence version: 133 DIP protein Q13257 original sequence version: 78 DIP protein Q13257 original sequence version: 105 DIP protein Q13257 original sequence version: 120 DIP protein Q13257 original sequence version: 127 DIP protein Q13257 original sequence version: 116 DIP protein Q13257 original sequence version: 150 DIP protein Q13257 original sequence version: 156 DIP protein Q13257 original sequence version: 134 B8DCBF0043836764 cut7-1 8 11 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-850 Region 1-850 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mad1-cut7-1 2 11 unspecified role unspecified role prey prey Region 475-1085 Region 475-1085 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mad1-mad2-7 3 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 59-689 Region 59-689 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P87169:p.[Arg523Ala;Val524Ala;Leu525Ala;Gln526Ala] R523A/V524A/L525A/Q526A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R523A/V524A/L525A/Q526A'. Wed May 02 20:26:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg523ala,val524ala,leu525ala,gln526ala' Tue Jun 30 17:37:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg523Ala;Val524Ala;Leu525Ala;Gln526Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mad1-cut7-2 7 11 unspecified role unspecified role prey prey Region 475-1085 Region 475-1085 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 14-59 Region 14-59 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 31-40 Region 31-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P87169:p.[Lys37Ala;Lys38Ala] K37A/K38A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K37A/K38A'. Wed May 02 19:18:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys37ala,lys38ala' Tue Jun 30 19:12:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys37Ala;Lys38Ala]' Region 23-30 Region 23-30 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P87169:p.[Leu28Ala;Pro29Ala;Arg30Ala;Phe31Ala;Leu32Ala] L28A/P29A/R30A/F31A/L32A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L28A/P29A/R30A/F31A/L32A'. Wed May 02 19:24:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu28ala,pro29ala,arg30ala,phe31ala,leu32ala' Tue Jun 30 18:17:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu28Ala;Pro29Ala;Arg30Ala;Phe31Ala;Leu32Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mad1l1-cenpe-1 6 14 unspecified role unspecified role prey prey Region 1958-2663 Region 1958-2663 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9Y6D9:p.[Leu17Ala;Asn18Ala;Asn19Ala;Phe20Ala;Ile21Ala] L17A/N18A/N19A/F20A/I21A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L17A/N18A/N19A/F20A/I21A'. Wed May 02 20:27:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu17ala,asn18ala,asn19ala,phe20ala,ile21ala' Tue Jun 30 19:41:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu17Ala;Asn18Ala;Asn19Ala;Phe20Ala;Ile21Ala]' ecolx Escherichia coli direct interaction direct interaction mad1-mad2-8 4 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mad1-cut7-3 1 11 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role bait bait Region 31-40 Region 31-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P87169:p.[Lys37Ala;Lys38Ala] K37A/K38A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K37A/K38A'. Wed May 02 16:25:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys37ala,lys38ala' Tue Jun 30 18:57:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys37Ala;Lys38Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P87169:p.[Leu28Ala;Pro29Ala;Arg30Ala;Phe31Ala;Leu32Ala] L28A/P29A/R30A/F31A/L32A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L28A/P29A/R30A/F31A/L32A'. Wed May 02 16:54:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu28ala,pro29ala,arg30ala,phe31ala,leu32ala' Tue Jun 30 16:35:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu28Ala;Pro29Ala;Arg30Ala;Phe31Ala;Leu32Ala]' ecolx Escherichia coli direct interaction direct interaction mad1l1-cenpe-2 9 14 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait human Homo sapiens Human association association mad1-mad1-1 5 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cenpe-mad1l1-1 10 14 unspecified role unspecified role bait bait Region 1958-2663 Region 1958-2663 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 15 unspecified role unspecified role prey prey Q9Y6D9:p.[Leu17Ala;Asn18Ala;Asn19Ala;Phe20Ala;Ile21Ala] L17A/N18A/N19A/F20A/I21A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L17A/N18A/N19A/F20A/I21A'. Wed May 02 15:34:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu17ala,asn18ala,asn19ala,phe20ala,ile21ala' Tue Jun 30 16:30:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu17Ala;Asn18Ala;Asn19Ala;Phe20Ala;Ile21Ala]' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association