DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267106X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267113X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267092X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267088X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267097X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267095X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267101X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267109X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267112X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267091X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267107X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267093X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267099X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267100X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267105X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267111X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267117X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267104X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267102X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267096X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267115X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267098X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267094X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267110X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267089X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267090X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267108X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267114X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267087X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267103X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature 2015 imex curation Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Yao J., Ke J., Zhang L., Lam VQ., Xin XF., Zhou XE., Chen J., Brunzelle J., Griffin PR., Zhou M., Xu HE., Melcher K., He SY. DIP original experiment: DIP-267116X Nature 2015 IMEx Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. tif6b_arath Protein TIFY 6B TIFY6B JAI3 JAZ3 MEB5.8 At3g17860 Jasmonate ZIM domain-containing protein 3 Protein JASMONATE INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT DIP protein Q9LVI4 original sequence version: 75 DIP protein Q9LVI4 original sequence version: 51 DIP protein Q9LVI4 original sequence version: 72 DIP protein Q9LVI4 original sequence version: 81 DIP protein Q9LVI4 original sequence version: 91 D65DEEA2F04C58E4 ti10b_arath Protein TIFY 10B TIFY10B JAZ2 F9E10.20 F25A4.8 At1g74950 Jasmonate ZIM domain-containing protein 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSFSAECWDFSGRKPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKPTNPAWLSSR DIP protein Q9S7M2 original sequence version: 51 DIP protein Q9S7M2 original sequence version: 81 DIP protein Q9S7M2 original sequence version: 90 7410B2A50505A543 ti11a_arath Protein TIFY 11A TIFY11A JAZ5 Jasmonate ZIM domain-containing protein 5 F1L3.3 F28G4.16 At1g17380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSNENAKAQAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPGKQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPGSSQLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPTDNNHLTKEQQQQQEQNQIVERIARRASLHRFFAKRKDRAVARAPYQVNQNAGHHRYPPKPEIVTGQPLEAGQSSQRPPDNAIGQTMAHIKSDGDKDDIMKIEEGQSSKDLDLRL DIP protein Q9LDU5 original sequence version: 50 DIP protein Q9LDU5 original sequence version: 78 DIP protein Q9LDU5 original sequence version: 87 54A55E02C18E5BAF myc4_arath Transcription factor MYC4 MYC4 BHLH4 Basic helix-loop-helix protein 4 EN37 Transcription factor EN 37 bHLH transcription factor bHLH004 T6K21.60 At4g17880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPTNVQVTDYHLNQSKTDTTNLWSTDDDASVMEAFIGGGSDHSSLFPPLPPPPLPQVNEDNLQQRLQALIEGANENWTYAVFWQSSHGFAGEDNNNNNTVLLGWGDGYYKGEEEKSRKKKSNPASAAEQEHRKRVIRELNSLISGGVGGGDEAGDEEVTDTEWFFLVSMTQSFVKGTGLPGQAFSNSDTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATENGVVELGSSEIIHQSSDLVDKVDTFFNFNNGGGEFGSWAFNLNPDQGENDPGLWISEPNGVDSGLVAAPVMNNGGNDSTSNSDSQPISKLCNGSSVENPNPKVLKSCEMVNFKNGIENGQEEDSSNKKRSPVSNNEEGMLSFTSVLPCDSNHSDLEASVAKEAESNRVVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYISELKSKLQKAESDKEELQKQIDVMNKEAGNAKSSVKDRKCLNQESSVLIEMEVDVKIIGWDAMIRIQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNQFFTQDQLKVALTEKVGECP C962E83290DF9CCC tif3b_arath Protein TIFY 3B TIFY3B JAZ12 Jasmonate ZIM domain-containing protein 12 F22D1.70 At5g20900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKVKDEPRASVEGGCGVADGDGGAAEIGGTGSVEKSINEVRSTEIQTAEPTVPPNQLTIFFGGSVTVFDGLPSEKVQEILRIAAKAMETKNSTSISPVSSPALNRAPSFSSTSNVASPAAQPFPIQPISFCRSTADLPIARRHSLQRFLEKRRDRLVNKNPYPTSDFKKTDVPTGNVSIKEEFPTA DIP protein Q9C5K8 original sequence version: 48 DIP protein Q9C5K8 original sequence version: 86 4F0C66DECBB4F0E1 tif6a_arath Protein TIFY 6A TIFY6A JAZ4 Jasmonate ZIM domain-containing protein 4 T1N15.11 At1g48500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKLSPITVKEETNEDSAPSRGMMDWSFSSKVGSGPQFLSFGTSQQETRVNTVNDHLLSSAAMDQNQRTYFSSLQEDRVFPGSSQQDQTTITVSMSEPNYINSFINHQHLGGSPIMAPPVSVFPAPTTIRSSSKPLPPQLTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHAKPVSQPKPQKLVHHSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLASTRNNQTAAFSMAPTVGLPQTRKASLARFLEKRKERVINVSPYYVDNKSSIDCRTLMSECVSCPPAHHLH DIP protein Q58G47 original sequence version: 31 DIP protein Q58G47 original sequence version: 58 DIP protein Q58G47 original sequence version: 68 83E08ACF3E387ADC myc2_arath Transcription factor MYC2 MYC2 BHLH6 Basic helix-loop-helix protein 6 EN38 JAI1 JIN1 Protein JASMONATE INSENSITIVE 1 R-homologous Arabidopsis protein 1 RAP1 RD22BP1 Transcription factor EN 38 Z-box binding factor 1 protein ZBF1 bHLH transcription factor bHLH006 rd22BP1 F6N18.4 At1g32640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSSPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSSDLINKVRILFNFDGGAGDLSGLNWNLDPDQGENDPSMWINDPIGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFSTSSSTLVKPRSGEILNFGDEGKRSSGNPDPSSYSGQTQFENKRKRSMVLNEDKVLSFGDKTAGESDHSDLEASVVKEVAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG DIP protein Q39204 original sequence version: 109 DIP protein Q39204 original sequence version: 104 DIP protein Q39204 original sequence version: 107 DIP protein Q39204 original sequence version: 126 4A8D4DE34C5928F6 tif9_arath Protein TIFY 9 TIFY9 JAS1 JAZ10 Protein JASMONATE-ASSOCIATED 1 Jasmonate ZIM domain-containing protein 10 Protein JAZ10 T31B5.40 At5g13220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKATIELDFLGLEKKQTNNAPKPKFQKFLDRRRSFRDIQGAISKIDPEIIKSLLASTGNNSDSSAKSRSVPSTPREDQPQIPISPVHASLARSSTELVSGTVPMTIFYNGSVSVFQVSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQNLEGDLPIARRKSLQRFLEKRKERLVSTSPYYPTSA DIP protein Q93ZM9 original sequence version: 44 DIP protein Q93ZM9 original sequence version: 70 DIP protein Q93ZM9 original sequence version: 79 475DADBCEDC540E1 ti11b_arath Protein TIFY 11B TIFY11B JAZ6 Jasmonate ZIM domain-containing protein 6 T10D10.8 At1g72450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTGQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKGQQNVIKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVMVFNEFPEDKAKEIMEVAKEANHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL DIP protein Q9C9E3 original sequence version: 44 DIP protein Q9C9E3 original sequence version: 70 DIP protein Q9C9E3 original sequence version: 78 E67821C53F6B138F tif3a_arath Protein TIFY 3A TIFY3A JAZ11 Jasmonate ZIM domain-containing protein 11 T18D12.10 At3g43440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEVNGDFPVPSFADGTGSVSAGLDLLVERSIHEARSTEPDASTQLTIIFGGSCRVFNGVPAQKVQEIIRIAFAGKQTKNVTGINPALNRALSFSTVADLPIARRRSLQRFLEKRRDRSTKPDGSMILPSQLTIIFGGSFSVFDGIPAEKVQEILHIAAAAKATETINLTSINPALKRAISFSNASTVACVSTADVPIARRRSLQRFFEKRRHRFVHTKPYSATTSEADKNETSPIVT DIP protein Q9M246 original sequence version: 49 DIP protein Q9M246 original sequence version: 85 841F602E9BE9EE9E tif7_arath Protein TIFY 7 TIFY7 JAZ9 F5A18.12 At1g70700 Jasmonate ZIM domain-containing protein 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLSDKQYLSNNVKHEVNDDAVEERGLSTKAAREWGKSKVFATSSFMPSSDFQEAKAFPGAYQWGSVSAANVFRRCQFGGAFQNATPLLLGGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPYKKMLLDLSTGESSGMNYSSTSPT DIP protein Q8W4J8 original sequence version: 38 DIP protein Q8W4J8 original sequence version: 58 DIP protein Q8W4J8-1 original sequence version: 59 DIP protein Q8W4J8 original sequence version: 68 DIP protein Q8W4J8-1 original sequence version: 78 855ACCF25C47B650 coi1_arath Coronatine-insensitive protein 1 FBL2 At2g39940 COI1 COI-1 F-box/LRR-repeat protein 2 T28M21.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQRTDCPTTVRVLKEPI DIP protein O04197 original sequence version: 103 DIP protein O04197 original sequence version: 98 DIP protein O04197 original sequence version: 80 DIP protein O04197 original sequence version: 84 DIP protein O04197 original sequence version: 101 DIP protein O04197 original sequence version: 119 1DDCF04990144C06 ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI DIP protein Q9LMA8 original sequence version: 76 DIP protein Q9LMA8 original sequence version: 72 DIP protein Q9LMA8 original sequence version: 51 DIP protein Q9LMA8 original sequence version: 57 DIP protein Q9LMA8 original sequence version: 74 DIP protein Q9LMA8 original sequence version: 81 DIP protein Q9LMA8 original sequence version: 92 EF2DAAC0CEF2DBBB q7xyy2-1 Mediator of RNA polymerase II transcription subunit 25 MED25 MED25_1 PFT1 F2J7.4 At1g25540 Phytochrome and flowering time 1 protein Phytochrome and flowering time regulatory protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSEVKQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSTVELSLVIFNSHGSYCACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFSPPSGQAQPSNDLKRHCILITASNPHILPTPVYRPRLQNVERNENGDAQAESRLSDAETVASYFAKCSVSLSVVCPKQLPTIRALYNAGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSHSATNLPQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTVTSMAPVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAENAPDIKPVVVSGMTPPLRTGPPGGANVNLLNNLSQVRQVMSSAALAGAASSVGQSAVAMHMSNMISTGMATSLPPSQTVFSTGQQGITSMAGSGALMGSAQTGQSPGPNNAFSPQTTSNVASNLGVSQPMQGMNQGSHSGAMMQGGISMNQNMMSGLGQGNVSSGTGGMMPTPGVGQQAQSGIQQLGGSNSSAPNMQLSQPSSGAMQTSQSKYVKVWEGNLSGQRQGQPVLITRLEGYRSASASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPNQQQQQQQQLHQQQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQQQQQQHQLSQLQHHQQQQQQQQQQQQQHQLTQLQHHHQQQQQASPLNQMQQQTSPLNQMQQQTSPLNQMQQQQQPQQMVMGGQAFAQAPGRSQQGGGGGQPNMPGAGFMG DIP protein Q7XYY2-1 original sequence version: 81 DIP protein Q7XYY2-1 original sequence version: 57 tif5a_arath Protein TIFY 5A TIFY5A JAZ8 Jasmonate ZIM domain-containing protein 8 T2H7 At1g30135 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIRIQATSPYHSRR DIP protein Q8LBM2 original sequence version: 35 DIP protein Q8LBM2 original sequence version: 62 DIP protein Q8LBM2 original sequence version: 71 4C4F6E24842E5B2B myc3_arath Transcription factor MYC3 MYC3 ATR2 BHLH5 EN36 Basic helix-loop-helix protein 5 Protein ALTERED TRYPTOPHAN REGULATION 2 Transcription factor ATR2 Transcription factor EN 36 bHLH transcription factor bHLH005 MZA15.18 At5g46760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGTTSSINFLTSDDDASAAAMEAFIGTNHHSSLFPPPPQQPPQPQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEEDKEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNGVGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVISQSSDLMHKVNNLFNFNNGGGNNGVEASSWGFNLNPDQGENDPALWISEPTNTGIESPARVNNGNNSNSNSKSDSHQISKLEKNDISSVENQNRQSSCLVEKDLTFQGGLLKSNETLSFCGNESSKKRTSVSKGSNNDEGMLSFSTVVRSAANDSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKVALMTKVGENY DIP protein Q9FIP9 original sequence version: 49 DIP protein Q9FIP9 original sequence version: 93 myc3-tify7-1 29 42 unspecified role unspecified role unspecified role unspecified role Region 218-239 Region 218-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 47 unspecified role unspecified role unspecified role unspecified role Region 44-238 Region 44-238 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction myc4-tify7-1 19 35 unspecified role unspecified role unspecified role unspecified role Region 55-253 Region 55-253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 42 unspecified role unspecified role unspecified role unspecified role Region 218-239 Region 218-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction tify10b-myc3-1 8 33 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 20:10:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 17:45:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 18:28:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 17:10:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 19:36:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 19:32:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 18:56:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 18:05:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 16:49:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 18:19:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 14:58:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 20:22:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' Q9FIP9:p.Phe151Ala F151A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 19:14:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 15:59:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.Leu152Ala L152A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 17:47:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 18:42:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify7-coi1-1 12 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role bait bait Q8W4J8:p.[Ser218Ala;Val219Ala;Pro220Ala;Gln221Ala] S218A/V219A/P220A/Q221A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S218A/V219A/P220A/Q221A'. Wed May 02 15:52:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser218ala,val219ala,pro220ala,gln221ala' Tue Jun 30 16:27:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser218Ala;Val219Ala;Pro220Ala;Gln221Ala]' Q8W4J8:p.Phe230Ala F230A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F230A'. Wed May 02 16:33:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe230ala' Tue Jun 30 18:47:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe230Ala' Q8W4J8:p.Leu231Ala L231A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L231A'. Wed May 02 18:14:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu231ala' Tue Jun 30 18:07:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu231Ala' Q8W4J8:p.Arg234Ala R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R234A'. Wed May 02 18:36:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg234ala' Tue Jun 30 17:10:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Ala' Q8W4J8:p.[Arg223Ala;Lys224Ala] R223A/K224A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R223A/K224A'. Wed May 02 16:38:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg223ala,lys224ala' Tue Jun 30 17:55:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg223Ala;Lys224Ala]' Region 218-267 Region 218-267 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc3-tify10a-1 4 44 unspecified role unspecified role unspecified role unspecified role Region 200-221 Region 200-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 47 unspecified role unspecified role unspecified role unspecified role Region 44-238 Region 44-238 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction med25-myc3-1 23 45 unspecified role unspecified role unspecified role unspecified role Region 540-680 Region 540-680 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 47 unspecified role unspecified role unspecified role unspecified role Region 44-238 Region 44-238 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tify5a-myc3-1 28 46 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 18:48:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 18:18:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 19:45:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 17:25:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 17:59:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 16:57:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 18:56:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 17:14:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 16:51:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 15:54:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 17:25:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 19:03:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 18:47:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 17:30:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify7-myc4-1 7 35 unspecified role unspecified role prey prey Region 55-253 Region 55-253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify7-myc3-1 25 42 unspecified role unspecified role bait bait Q8W4J8:p.Leu227Ala L227A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L227A'. Wed May 02 15:50:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu227ala' Tue Jun 30 19:51:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu227Ala' Q8W4J8:p.Phe230Ala F230A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F230A'. Wed May 02 16:32:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe230ala' Tue Jun 30 20:15:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe230Ala' Q8W4J8:p.Leu231Ala L231A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L231A'. Wed May 02 18:59:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu231ala' Tue Jun 30 17:21:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu231Ala' Q8W4J8:p.Arg234Ala R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R234A'. Wed May 02 17:42:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg234ala' Tue Jun 30 16:17:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Ala' Region 218-238 Region 218-238 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 218-246 Region 218-246 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc3-tify7-2 6 42 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco 47 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association tify6b-myc3-1 24 32 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Asp94Ala;Tyr97Ala] D94A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A Fri Jul 28 10:42:39 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_tyr94-97ala_ala' Wed May 02 15:14:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94ala,tyr97ala' Tue Jun 30 17:55:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp94Ala;Tyr97Ala]' Q9FIP9:p.Leu152Ala L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 19:29:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 18:36:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' Q9FIP9:p.Met155Ala M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M155A'. Wed May 02 17:13:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met155ala' Tue Jun 30 15:52:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met155Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 16:52:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 19:45:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 14:45:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 18:32:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 18:28:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 16:25:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.Asp94Asn D94N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D94N'. Wed May 02 14:54:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94asn' Tue Jun 30 19:48:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp94Asn' Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 17:53:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 19:46:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 18:11:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 18:33:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 16:28:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 20:13:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 14:33:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 20:16:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc4-tify3b-1 18 36 unspecified role unspecified role unspecified role unspecified role Region 137-158 Region 137-158 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 35 unspecified role unspecified role unspecified role unspecified role Region 55-253 Region 55-253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction myc3-med25-1 20 45 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tobac Nicotiana tabacum (Common tobacco) Common tobacco 47 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association tify7-myc2-7 26 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role bait bait Q8W4J8:p.Leu227Ala L227A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L227A'. Wed May 02 14:34:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu227ala' Tue Jun 30 17:23:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu227Ala' Q8W4J8:p.Phe230Ala F230A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F230A'. Wed May 02 20:19:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe230ala' Tue Jun 30 17:40:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe230Ala' Q8W4J8:p.Leu231Ala L231A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L231A'. Wed May 02 20:32:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu231ala' Tue Jun 30 17:11:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu231Ala' Q8W4J8:p.Arg234Ala R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R234A'. Wed May 02 15:29:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg234ala' Tue Jun 30 15:56:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc3-tify11b-1 2 40 unspecified role unspecified role unspecified role unspecified role 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 18:58:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 19:22:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Asp94Ala;Tyr97Ala] D94A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D94A/Y97A'. Wed May 02 17:51:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94ala,tyr97ala' Tue Jun 30 17:11:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp94Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 17:56:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 17:04:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 14:46:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 19:13:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.Leu152Ala L152A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 19:31:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 18:14:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' Q9FIP9:p.Met155Ala M155A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M155A'. Wed May 02 18:47:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met155ala' Tue Jun 30 16:58:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met155Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 16:57:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 17:55:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 17:48:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 18:34:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 20:11:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 18:25:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 15:20:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 18:54:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc4-tify5a-1 30 46 unspecified role unspecified role unspecified role unspecified role Region 101-122 Region 101-122 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 35 unspecified role unspecified role unspecified role unspecified role Region 55-253 Region 55-253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tify3b-myc3-1 17 36 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 16:26:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 15:43:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 15:09:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 18:22:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 20:06:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 18:29:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.Leu152Ala L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 14:27:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 17:47:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' Q9FIP9:p.Met155Ala M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M155A'. Wed May 02 15:28:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met155ala' Tue Jun 30 20:04:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met155Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 17:18:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 19:05:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 20:29:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 17:58:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 20:23:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 15:49:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 19:18:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 18:26:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc3-tify7-3 5 42 unspecified role unspecified role unspecified role unspecified role Region 218-239 Region 218-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 47 unspecified role unspecified role unspecified role unspecified role Region 44-238 Region 44-238 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tify7-myc4-2 10 35 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role bait bait Q8W4J8:p.Leu227Ala L227A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L227A'. Wed May 02 15:18:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu227ala' Tue Jun 30 18:16:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu227Ala' Q8W4J8:p.Phe230Ala F230A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F230A'. Wed May 02 18:27:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe230ala' Tue Jun 30 18:38:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe230Ala' Q8W4J8:p.Leu231Ala L231A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L231A'. Wed May 02 19:52:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu231ala' Tue Jun 30 15:47:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu231Ala' Q8W4J8:p.Arg234Ala R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R234A'. Wed May 02 16:27:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg234ala' Tue Jun 30 16:06:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify6a-myc3-1 16 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Asp94Ala;Tyr97Ala] D94A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D94A/Y97A'. Wed May 02 17:13:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94ala,tyr97ala' Tue Jun 30 15:54:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp94Ala;Tyr97Ala]' Q9FIP9:p.Leu152Ala L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 17:58:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 18:33:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' Q9FIP9:p.Met155Ala M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M155A'. Wed May 02 18:33:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met155ala' Tue Jun 30 17:35:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met155Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 20:14:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 20:01:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 16:14:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 20:18:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 20:31:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 17:52:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.Asp94Asn D94N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D94N'. Wed May 02 15:27:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94asn' Tue Jun 30 16:17:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp94Asn' Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 18:47:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 15:43:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 18:07:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 18:07:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 19:19:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 19:32:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 15:22:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 17:16:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' Q9FIP9:p.Trp92Ala W92A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A'. Wed May 02 14:41:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala' Tue Jun 30 19:45:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp92Ala' Q9FIP9:p.Asp94Ala D94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D94A'. Wed May 02 16:45:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94ala' Tue Jun 30 19:28:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp94Ala' Q9FIP9:p.Tyr97Ala Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y97A'. Wed May 02 14:57:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr97ala' Tue Jun 30 16:12:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr97Ala' Q9FIP9:p.[Trp92Ala;Asp94Ala] W92A/D94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A'. Wed May 02 16:18:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala' Tue Jun 30 20:17:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc2-tify5a-3 1 46 unspecified role unspecified role unspecified role unspecified role Region 101-122 Region 101-122 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 38 unspecified role unspecified role unspecified role unspecified role Region 55-259 Region 55-259 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction myc3-tify5a-1 22 46 unspecified role unspecified role unspecified role unspecified role Region 101-122 Region 101-122 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 47 unspecified role unspecified role unspecified role unspecified role Region 44-238 Region 44-238 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tify3a-myc3-1 31 41 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 15:55:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 18:18:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 18:35:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 18:40:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 17:08:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 17:03:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 19:42:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 18:04:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 20:32:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 16:32:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 19:04:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 19:52:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 20:02:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 16:30:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.Leu152Ala L152A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 14:36:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 17:39:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc2-tify7-4 15 38 unspecified role unspecified role unspecified role unspecified role Region 55-259 Region 55-259 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 42 unspecified role unspecified role unspecified role unspecified role Region 218-239 Region 218-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction myc3-tify3b-1 13 36 unspecified role unspecified role unspecified role unspecified role Region 137-158 Region 137-158 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 47 unspecified role unspecified role unspecified role unspecified role Region 44-238 Region 44-238 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tify11a-myc3-1 9 34 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 16:51:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 19:47:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Asp94Ala;Tyr97Ala] D94A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D94A/Y97A'. Wed May 02 14:54:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94ala,tyr97ala' Tue Jun 30 18:44:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp94Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 16:10:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 16:08:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 16:21:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 19:19:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.Leu152Ala L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 14:42:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 19:10:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' Q9FIP9:p.Met155Ala M155A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M155A'. Wed May 02 19:10:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met155ala' Tue Jun 30 20:22:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met155Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 16:50:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 18:30:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 15:03:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 18:43:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 19:53:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 20:21:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 17:30:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 19:36:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify7-myc3-2 3 42 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Asp94Ala;Tyr97Ala] D94A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D94A/Y97A'. Wed May 02 16:37:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94ala,tyr97ala' Tue Jun 30 20:02:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp94Ala;Tyr97Ala]' Q9FIP9:p.Leu152Ala L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 15:57:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 15:43:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' Q9FIP9:p.Met155Ala M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M155A'. Wed May 02 18:35:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met155ala' Tue Jun 30 20:02:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met155Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 18:46:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 17:26:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 20:26:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 17:21:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 16:50:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 19:04:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Region 44-234 Region 44-234 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9FIP9:p.Asp94Asn D94N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D94N'. Wed May 02 15:36:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp94asn' Tue Jun 30 16:42:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp94Asn' Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 16:32:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 19:00:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 16:20:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 19:14:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 19:59:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 16:33:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 17:16:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 16:30:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify10a-myc3-1 27 44 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 19:56:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 16:05:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 19:44:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 16:23:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 16:06:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 16:18:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 16:34:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 18:18:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 19:40:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 19:51:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 14:53:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 18:02:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' Q9FIP9:p.Phe151Ala F151A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 20:27:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 19:52:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.Leu152Ala L152A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 17:13:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 18:09:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify7-myc2-8 14 38 unspecified role unspecified role prey prey Region 55-259 Region 55-259 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tify9-myc3-1 21 39 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role prey prey Q9FIP9:p.[Trp92Ala;Tyr97Ala] W92A/Y97A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/Y97A'. Wed May 02 18:26:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,tyr97ala' Tue Jun 30 18:43:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Tyr97Ala]' Q9FIP9:p.[Trp92Ala;Asp94Ala;Tyr97Ala] W92A/D94A/Y97A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W92A/D94A/Y97A'. Wed May 02 17:49:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp92ala,asp94ala,tyr97ala' Tue Jun 30 19:56:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp92Ala;Asp94Ala;Tyr97Ala]' Q9FIP9:p.Phe151Ala F151A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A'. Wed May 02 15:57:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala' Tue Jun 30 18:39:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe151Ala' Q9FIP9:p.[Phe151Ala;Leu152Ala;Met155Ala] F151A/L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A/M155A'. Wed May 02 19:33:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala,met155ala' Tue Jun 30 20:10:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala;Met155Ala]' Q9FIP9:p.[Phe151Ala;Leu152Ala] F151A/L152A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/L152A'. Wed May 02 17:30:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,leu152ala' Tue Jun 30 20:04:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Leu152Ala]' Q9FIP9:p.[Phe151Ala;Met155Ala] F151A/M155A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F151A/M155A'. Wed May 02 18:04:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe151ala,met155ala' Tue Jun 30 18:38:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe151Ala;Met155Ala]' Q9FIP9:p.[Leu152Ala;Met155Ala] L152A/M155A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A/M155A'. Wed May 02 15:37:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala,met155ala' Tue Jun 30 16:26:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu152Ala;Met155Ala]' Q9FIP9:p.Leu152Ala L152A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L152A'. Wed May 02 17:43:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152ala' Tue Jun 30 19:27:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myc2-tify3b-4 11 36 unspecified role unspecified role unspecified role unspecified role Region 137-158 Region 137-158 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 38 unspecified role unspecified role unspecified role unspecified role Region 55-259 Region 55-259 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction