DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. PLoS biology 2015 imex curation Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. DIP original experiment: DIP-265410X PLoS biology 2015 IMEx The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. PLoS biology 2015 imex curation Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. DIP original experiment: DIP-265412X PLoS biology 2015 IMEx The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. PLoS biology 2015 imex curation Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. DIP original experiment: DIP-265413X PLoS biology 2015 IMEx The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. PLoS biology 2015 imex curation Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gógl G., Schneider KD., Yeh BJ., Alam N., Nguyen Ba AN., Moses AM., Hetényi C., Reményi A., Weiss EL. DIP original experiment: DIP-265411X PLoS biology 2015 IMEx The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism. ssd1_yeast Protein SSD1 SSD1 CLA1 RLD1 SRK1 YDR293C D9819.4 Protein SRK1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKNSNVNNNRSQEPNNMFVQTTGGGKNAPKQIHVAHRRSQSELTNLMIEQFTLQKQLEQVQAQQQQLMAQQQQLAQQTGQYLSGNSGSNNHFTPQPPHPHYNSNGNSPGMSAGGSRSRTHSRNNSGYYHNSYDNNNNSNNPGSNSHRKTSSQSSIYGHSRRHSLGLNEAKKAAAEEQAKRISGGEAGVTVKIDSVQADSGSNSTTEQSDFKFPPPPNAHQGHRRATSNLSPPSFKFPPNSHGDNDDEFIATSSTHRRSKTRNNEYSPGINSNWRNQSQQPQQQLSPFRHRGSNSRDYNSFNTLEPPAIFQQGHKHRASNSSVHSFSSQGNNNGGGRKSLFAPYLPQANIPELIQEGRLVAGILRVNKKNRSDAWVSTDGALDADIYICGSKDRNRALEGDLVAVELLVVDDVWESKKEKEEKKRRKDASMQHDLIPLNSSDDYHNDASVTAATSNNFLSSPSSSDSLSKDDLSVRRKRSSTINNDSDSLSSPTKSGVRRRSSLKQRPTQKKNDDVEVEGQSLLLVEEEEINDKYKPLYAGHVVAVLDRIPGQLFSGTLGLLRPSQQANSDNNKPPQSPKIAWFKPTDKKVPLIAIPTELAPKDFVENADKYSEKLFVASIKRWPITSLHPFGILVSELGDIHDPDTEIDSILRDNNFLSNEYLDQKNPQKEKPSFQPLPLTAESLEYRRNFTDTNEYNIFAISELGWVSEFALHVRNNGNGTLELGCHVVDVTSHIEEGSSVDRRARKRSSAVFMPQKLVNLLPQSFNDELSLAPGKESATLSVVYTLDSSTLRIKSTWVGESTISPSNILSLEQLDEKLSTGSPTSYLSTVQEIARSFYARRINDPEATLLPTLSLLESLDDEKVKVDLNILDRTLGFVVINEIKRKVNSTVAEKIYTKLGDLALLRRQMQPIATKMASFRKKIQNFGYNFDTNTADELIKGVLKIKDDDVRVGIEILLFKTMPRARYFIAGKVDPDQYGHYALNLPIYTHFTAPMRRYADHVVHRQLKAVIHDTPYTEDMEALKITSEYCNFKKDCAYQAQEQAIHLLLCKTINDMGNTTGQLLTMATVLQVYESSFDVFIPEFGIEKRVHGDQLPLIKAEFDGTNRVLELHWQPGVDSATFIPADEKNPKSYRNSIKNKFRSTAAEIANIELDKEAESEPLISDPLSKELSDLHLTVPNLRLPSASDNKQNALEKFISTTETRIENDNYIQEIHELQKIPILLRAEVGMALPCLTVRALNPFMKRV 3D50FD6838ECA514 3D50FD6838ECA514 cbk1_yeast Serine/threonine-protein kinase CBK1 CBK1 YNL161W N1727 Cell wall biosynthesis kinase protein protein yeast Saccharomyces cerevisiae Baker's yeast MYNSSTNHHEGAPTSGHGYYMSQQQDQQHQQQQQYANEMNPYQQIPRPPAAGFSSNYMKEQGSHQSLQEHLQRETGNLGSGFTDVPALNYPATPPPHNNYAASNQMINTPPPSMGGLYRHNNNSQSMVQNGNGSGNAQLPQLSPGQYSIESEYNQNLNGSSSSSPFHQPQTLRSNGSYSSGLRSVKSFQRLQQEQENVQVQQQLSQAQQQNSRQQQQQLQYQQQQQQQQQQQHMQIQQQQQQQQQQQQSQSPVQSGFNNGTISNYMYFERRPDLLTKGTQDKAAAVKLKIENFYQSSVKYAIERNERRVELETELTSHNWSEERKSRQLSSLGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATNGISKPGTYNANTTDTANKRQTMVVDSISLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMTKQGGSAPVKEDLPFIGYTYSRFDYLTRKNAL 87EBCD2C3C96EE11 87EBCD2C3C96EE11 mob2_yeast CBK1 kinase activator protein MOB2 YFL035C YFL035C-A YFL034C-B MOB2 MPS1 binder 2 Maintenance of ploidy protein MOB2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFNFKAFGRNSKKNKNQPLNVAQPPAMNTIYSSPHSSNSRLSLRNKHHSPKRHSQTSFPAQKSTPQSQQLTSTTPQSQQQEASERSESQQIMFLSEPFVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNAGPHTDYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESFEKQGKIIYN CFBA15FF83BFAA33 CFBA15FF83BFAA33 ace2_yeast Metallothionein expression activator ACE2 L3123 L9606.10 YLR131C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDNVVDPWYINPSGFAKDTQDEEYVQHHDNVNPTIPPPDNYILNNENDDGLDNLLGMDYYNIDDLLTQELRDLDIPLVPSPKTGDGSSDKKNIDRTWNLGDENNKVSHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILNMSKDPQPMELINELGNHNTVKNNNDDFDHIRENDGENSYLSQVLLKQQEELRIALEKQKEVNEKLEKQLRDNQIQQEKLRKVLEEQEEVAQKLVSGATNSNSKPGSPVILKTPAMQNGRMKDNAIIVTTNSANGGYQFPPPTLISPRMSNTSINGSPSRKYHRQRYPNKSPESNGLNLFSSNSGYLRDSELLSFSPQNYNLNLDGLTYNDHNNTSDKNNNDKKNSTGDNIFRLFEKTSPGGLSISPRINGNSLRSPFLVGTDKSRDDRYAAGTFTPRTQLSPIHKKRESVVSTVSTISQLQDDTEPIHMRNTQNPTLRNANALASSSVLPPIPGSSNNTPIKNSLPQKHVFQHTPVKAPPKNGSNLAPLLNAPDLTDHQLEIKTPIRNNSHCEVESYPQVPPVTHDIHKSPTLHSTSPLPDEIIPRTTPMKITKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKKYICPCGKRFNREDALMVHRSRMICTGGKKLEHSINKKLTSPKKSLLDSPHDTSPVKETIARDKDGSVLMKMEEQLRDDMRKHGLLDPPPSTAAHEQNSNRTLSNETDAL A7FCA8C506A2FD75 A7FCA8C506A2FD75 cbk1-mob2-1 1 7 unspecified role unspecified role unspecified role unspecified role Region45-287 Region45-287 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 251-756 Region 251-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ssd1-cbk1-1 4 6 unspecified role unspecified role prey prey Region 352-756 Region 352-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role bait bait Region 211-214 Region 211-214 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 234-238 Region 234-238 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P24276:p.Phe211Ala F211A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F211A'. Wed May 02 20:04:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe211ala' Tue Jun 30 18:55:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe211Ala' P24276:p.Phe211Trp F211W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F W This feature has been corrected as a result of our quality control procedures. The original label was 'F211W'. Wed May 02 20:24:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe211trp' Tue Jun 30 17:02:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe211Trp' P24276:p.Lys212Ala K212A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K212A'. Wed May 02 14:24:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys212ala' Tue Jun 30 17:14:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys212Ala' P24276:p.Phe213Ala F213A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F213A'. Wed May 02 17:58:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe213ala' Tue Jun 30 18:43:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe213Ala' P24276:p.Phe213Trp F213W/Y mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F W Wed May 02 19:12:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe213trp' Tue Jun 30 17:26:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe213Trp' P24276:p.Pro214Ala P214A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P214A'. Wed May 02 19:11:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro214ala' Tue Jun 30 15:56:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro214Ala' P24276:p.Lys212Gln K212Q/S/T/D/M/F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K Q Wed May 02 19:51:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys212gln' Tue Jun 30 19:29:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys212Gln' MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P24276:p.Lys212Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K S Wed May 02 20:14:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys212ser' Tue Jun 30 17:34:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys212Ser' P24276:p.Lys212Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K T Wed May 02 16:55:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys212thr' Tue Jun 30 17:29:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys212Thr' P24276:p.Lys212Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K D Wed May 02 20:21:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys212asp' Tue Jun 30 19:19:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys212Asp' P24276:p.Lys212Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K M Wed May 02 18:55:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys212met' Tue Jun 30 17:07:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys212Met' P24276:p.Lys212Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K F Wed May 02 14:54:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys212phe' Tue Jun 30 19:13:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys212Phe' P24276:p.Phe213Tyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F Y Wed May 02 18:53:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe213tyr' Tue Jun 30 18:48:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe213Tyr' ecolx Escherichia coli direct interaction direct interaction ssd1-cbk1-2 3 6 unspecified role unspecified role prey prey Region 352-756 Region 352-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P53894:p.Tyr687Ala Y687A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y687A'. Wed May 02 16:30:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr687ala' Tue Jun 30 17:24:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr687Ala' ecolx Escherichia coli 5 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 208-214 Region 208-214 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ace2-cbk1-2 2 8 unspecified role unspecified role bait bait Region 272-286 Region 272-286 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P21192:p.Ile272Ala I272A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I272A'. Wed May 02 16:16:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile272ala' Tue Jun 30 17:52:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile272Ala' P21192:p.Asn277Ala N277A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N277A'. Wed May 02 15:29:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn277ala' Tue Jun 30 20:21:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn277Ala' P21192:p.Tyr283Ala Y283A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y283A'. Wed May 02 20:08:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr283ala' Tue Jun 30 19:07:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr283Ala' P21192:p.Phe285Ala F285A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F285A'. Wed May 02 20:19:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe285ala' Tue Jun 30 19:55:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe285Ala' P21192:p.Pro286Ala P286A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P286A'. Wed May 02 14:52:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro286ala' Tue Jun 30 19:43:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro286Ala' ecolx Escherichia coli 6 unspecified role unspecified role prey prey Region 251-756 Region 251-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction