DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266060X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266048X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266047X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266057X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266052X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266059X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266051X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266055X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266058X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266056X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266049X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266054X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266045X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266053X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266046X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nature structural & molecular biology 2015 imex curation Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266050X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. clock_mouse Circadian locomoter output cycles protein kaput Clock protein protein mouse Mus musculus Mouse MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ DIP protein O08785 original sequence version: 149 DIP protein O08785-1 original sequence version: 138 DIP protein O08785 original sequence version: 138 DIP protein O08785 original sequence version: 108 DIP protein O08785 original sequence version: 143 DIP protein O08785 original sequence version: 155 DIP protein O08785 original sequence version: 159 DIP protein O08785 original sequence version: 160 9864D947049742F4 ep300_mouse Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 Ep300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein mouse Mus musculus Mouse MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINSMVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGPQPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGMPSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQIPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINSQNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMNMPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTNMPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTPTPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSLPAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTEVNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGHLDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQPLPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMGAMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADLNSNLSQSTLDIH DIP protein B2RWS6 original sequence version: 53 DIP protein B2RWS6 original sequence version: 73 DIP protein B2RWS6 original sequence version: 79 0E9B2D9508237671 bmal2_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 2 Arntl2 Bmal2 Brain and muscle ARNT-like 2 protein protein mouse Mus musculus Mouse MEFPRKRRGRDSQPLQSEFMTDTTVESLPQNPFASLLSTRTGVSAPSGIREAHSQMEKRRRDKMNHLIQKLSSMIPPHIPTAHKLDKLSVLRRAVQYLRSLRGMTELYLGENSKPSFIQDKELSHLILKAAEGFLFVVGCERGRIFYVSKSVSKTLRYDQASLIGQNLFDFLHPKDVAKVKEQLSCDGSPREKPIDTKTSQVYSHPYTGRPRMHSGSRRSFFFRMKSCTVPVKEEQPCSSCSKKKDHRKFHTVHCTGYLRSWPLNVVGMEKESGGGKDSGPLTCLVAMGRLHPYIVPQKSGKINVRPAEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRVKDGAFVTLKSEWFSFTNPWTKELEYIVSVNTLVLGRSETRLSLLHCGGSSQSSEDSFRQSCINVPGVSTGTVLGAGSIGTDIANEVLSLQRLHSSSPEDASPSEEVRDDCSVNGGNAYGPASTREPFAVSPSETEVLEAARQHQSTEPAHPHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWAL DIP protein Q2VPD4 original sequence version: 81 DIP protein Q2VPD4-1 original sequence version: 90 D73F04B16CA0A363 cry1_mouse Cryptochrome-1 Cry1 protein protein mouse Mus musculus Mouse MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN DIP protein P97784 original sequence version: 119 DIP protein P97784 original sequence version: 108 DIP protein P97784 original sequence version: 86 DIP protein P97784 original sequence version: 110 DIP protein P97784 original sequence version: 113 DIP protein P97784 original sequence version: 125 DIP protein P97784 original sequence version: 130 DIP protein P97784 original sequence version: 95 2F2B8DD53F0A9AF9 cbp_mouse Histone lysine acetyltransferase CREBBP Crebbp Cbp Protein-lysine acetyltransferase CREBBP protein protein mouse Mus musculus Mouse MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHANNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTPTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRSEMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINNGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPVMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQPAMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSASLAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL DIP protein P45481 original sequence version: 148 DIP protein P45481 original sequence version: 126 DIP protein P45481 original sequence version: 152 DIP protein P45481 original sequence version: 115 DIP protein P45481 original sequence version: 127 DIP protein P45481 original sequence version: 123 DIP protein P45481 original sequence version: 149 DIP protein P45481 original sequence version: 156 DIP protein P45481 original sequence version: 169 DIP protein P45481 original sequence version: 175 DIP protein P45481 original sequence version: 135 D89AF52B7BD33347 q9wtl8-4 Aryl hydrocarbon receptor nuclear translocator-like protein 1 Arntl Bmal1 Arnt3 Brain and muscle ARNT-like 1 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein Q9WTL8-4 original sequence version: 140 837330EF65406CE4 arntl-clock-14 13 17 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association arntl2-cry1-1 12 19 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role Region 471-505 Region 471-505 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Rho-label Rho-label tetramethyl rhodamine label tetramethyl rhodamine label n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction arntl-ep300-1 16 22 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 565-653 Region 565-653 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clock-arntl-10 15 17 unspecified role unspecified role bait bait human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association arntl-crebbp-2 8 21 unspecified role unspecified role unspecified role unspecified role Region 586-665 Region 586-665 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9WTL8-4:p.[Leu606Ala;Leu607Ala] L606A/L607A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L606A/L607A'. Wed May 02 15:42:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu606ala,leu607ala' Tue Jun 30 17:06:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu606Ala;Leu607Ala]' ecolx Escherichia coli direct interaction direct interaction arntl-cry1-1 7 20 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 22 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9WTL8-4:p.Val602_Ile603delinsAlaPhe V603A/I604F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain VI AF Wed May 02 18:24:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_ile602-603ala_phe' Tue Jun 30 18:45:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val602_Ile603delinsAlaPhe' Q9WTL8-4:p.[Leu606Ala;Leu607Ala] L606A/L607A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L606A/L607A'. Wed May 02 18:46:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu606ala,leu607ala' Tue Jun 30 18:44:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu606Ala;Leu607Ala]' ecolx Escherichia coli direct interaction direct interaction arntl-crebbp-3 9 21 unspecified role unspecified role unspecified role unspecified role Region 586-665 Region 586-665 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction arntl2-clock-4 3 19 unspecified role unspecified role bait bait human Homo sapiens Human 17 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association arntl-cry1-2 5 20 unspecified role unspecified role unspecified role unspecified role Region 471-505 Region 471-505 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Rho-label Rho-label tetramethyl rhodamine label tetramethyl rhodamine label n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 22 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9WTL8-4:p.[Leu606Ala;Leu607Ala] L606A/L607A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L606A/L607A'. Wed May 02 15:40:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu606ala,leu607ala' Tue Jun 30 18:21:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu606Ala;Leu607Ala]' ecolx Escherichia coli direct interaction direct interaction clock-arntl2-2 2 19 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association arntl2-crebbp-1 10 19 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role Region 586-665 Region 586-665 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction arntl2-cry1-2 6 19 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction arntl-cry1-3 11 20 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 22 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cry1-arntl-7 4 22 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 17 unspecified role unspecified role prey prey O08785:p.[Gln361Pro;Trp362Arg] Q361P/W362R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W R certain certain sequence position certain certain certain sequence position certain Q P This feature has been corrected as a result of our quality control procedures. The original label was 'Q361P/W362R'. Wed May 02 18:42:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln361pro,trp362arg' Tue Jun 30 19:29:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln361Pro;Trp362Arg]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association arntl2-ep300-1 1 19 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 565-653 Region 565-653 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction arntl2-cry1-3 14 19 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction